Clone BO28226 Report

Search the DGRC for BO28226

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:282
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG8693-RA
Protein status:BO28226.pep: Imported from assembly
Sequenced Size:1771

Clone Sequence Records

BO28226.complete Sequence

1771 bp assembled on 2011-07-19

GenBank Submission: KX794994

> BO28226.complete
GAAGTTATCAGTCGACATGACCACTTGGACTAGCTTGTTCCTGCTTTTGG
GCCTTGGCCTTCTGGCTGTCGATGCCGCGGCGCCCTGGTGGAAGACCGCT
TCCTTCTACCAGATCTACCCGCGCTCCTTCAAAGACAGTGACGGAAATGG
AGTCGGAGACTTAAACGGGGTGACCGAGAAGCTGGAGTACCTTAAGGAGA
TCGGCGTGACCGCCACCTGGCTGTCTCCTTTTCTGAAATCCCCGATGGCA
GACTTTGGCTATGACATTTCCGATTTCAAGGCGGTCGACCCTCTTTTCGG
AACGATGGAGGACTTCGAGAATATGGTCTCCCGCGCCAAGGAGCTGGGTG
TCAAGATTATTCTCGACTTCGTGCCCAATCATTCCAGTGATGAGTGCGAT
TGGTTCCTTCGTTCGGCTGCCGGCGAGGAGGAGTACAAGGACTACTACAT
GTGGCACCCGGGATTCCTCGATGAGGACGGAACCCGTCGCCCGCCTACCA
ACTGGGTGAGCGTGTTCCGCGGCAGCGCATGGGAGTGGCACGAGGGTCGC
CAGGAGTACTATCTTCATCAATTCCACAAGAAGCAACCGGACTTCAACTT
CCGTAATCCCGTGGTGCGCGAGGAGATGAACAACGTGCTGCGATTCTGGC
TGGAAAAGGGCGTCGATGGTTTCCGCGTGGATGCCATCTACCACGCCTTT
GAGATTGAGGCCGACGAGAACGGAAACTATCCGGATGAGCCCCGCAACGA
TTGGACCAACGATCCAGATGAGTACGGATACACCCACAAGATCTACACTG
TGGATCAGCCAGAGACCCCGCACTTGGTATACGAATGGCGCCAAATTCTT
GAGCAGTTCCAGGCTGACAATGGCGGTGATGAGCGCATATTGATGGTGGA
GACCTGGTCCCCCATTGAAATCGTAATGCATTACTATGGCAACGAAACCG
CCGATGGAGCCCAGATACCGTTCAATTTCCAGCTGATAAGTAATCTGCAC
TACGATTCCGATGCCTATCATTACGAGTACTTGATTAACAACTGGCTTAA
TCTGATGCCAGAGGGGAAGAGCGCCAACTGGGTGATCGGTAACCATGACA
AGAACCGTGTGGGCTCTCGATTCGGAGCCGATCGAGTTGACCTCTTCAAC
ATCCTGCTTCTCACTCTGCCCGGCTGCAGCATCACGTACCAGGGCGAGGA
GCTGGGCATGCTCGACGGATATGTGTCCTGGGAGGACACCGTGGATCCGC
AAGCCTGCAACGGCTACGAGGCAAACTACATGGATAACTCCCGCGACCCA
GCCCGCACTCCGATGCACTGGTCGGATGAGACGATGGCTGGATTCACCAC
TGGCAACAGCACCTGGCTGCCGGTATCCACGGATTATCGCCAGAGGAACG
TGAAAACCGAGCGCGGCGTGTCCCTGAGCCACCTGAACGTGTTCAAGCGT
CTGCAGCAGCTCCGTCAGGAGCCCAGCATTGAAGAAGGATCCGCCGAGGT
CAAGGCTGTTAGCAACTACGTCCTGGCCGTCAAGCGCCACCTGAGCGGCG
ACTTCGTCTACATCTCTCTCTTCAACATCTTCGACTCCATCGAGAATGTG
AACCTATCCAGTGTGTTTGGCAGCCTGCCCGCCAAGTTCCAGTACGCCCT
GGTCACCGAGAAGTCCATCAAGAAGGTCGGCGACCAGGTGTCCGCCGGCA
GCGTCACCCTCATGCCCCACGAGTCCATTGTGCTGCGTTCCACAACAACA
GCTGCAAGCTTTCTAGACCAT

BO28226.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A4-RA 1740 CG8693-PA 1..1737 17..1753 8685 100 Plus
Mal-A3-RA 1725 CG8695-PA 277..438 296..457 300 79 Plus
Mal-A5-RC 1836 CG30359-PC 130..632 86..591 275 70.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A4-RA 1786 CG8693-RA 10..1746 17..1753 8685 100 Plus
Mal-A3-RA 1795 CG8695-RA 313..474 296..457 300 79 Plus
Mal-A5-RC 1988 CG30359-RC 222..724 86..591 275 70.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8458824..8459635 17..828 4060 100 Plus
2R 25286936 2R 8460094..8460546 1084..1536 2265 100 Plus
2R 25286936 2R 8460627..8460844 1536..1753 1090 100 Plus
2R 25286936 2R 8459809..8460008 885..1084 1000 100 Plus
2R 25286936 2R 8457357..8457518 457..296 300 79 Minus
2R 25286936 2R 8459697..8459753 829..885 285 100 Plus
2R 25286936 2R 8472078..8472269 85..276 240 75 Plus
2R 25286936 2R 8451519..8451801 388..106 230 72.1 Minus
2R 25286936 2R 8463133..8463533 188..591 230 71 Plus
Blast to na_te.dros performed on 2014-11-26 22:05:37 has no hits.

BO28226.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-19 13:40:23 Download gff for BO28226.complete
Subject Subject Range Query Range Percent Splice Strand
CG8693-RA 1..1737 17..1755 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:46:26 Download gff for BO28226.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A4-RA 10..1746 17..1755 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:50:58 Download gff for BO28226.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A4-RA 10..1746 17..1755 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:50:58 Download gff for BO28226.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8460628..8460844 1537..1755 99   Plus
2R 8460095..8460546 1085..1536 100 -> Plus
2R 8459810..8460008 886..1084 100 -> Plus
2R 8459697..8459753 829..885 100 -> Plus
2R 8458824..8459635 17..828 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:46:26 Download gff for BO28226.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4348133..4348349 1537..1755 99   Plus
arm_2R 4347600..4348051 1085..1536 100 -> Plus
arm_2R 4347315..4347513 886..1084 100 -> Plus
arm_2R 4347202..4347258 829..885 100 -> Plus
arm_2R 4346329..4347140 17..828 100 -> Plus

BO28226.pep Sequence

Translation from 16 to 1771

> BO28226.pep
MTTWTSLFLLLGLGLLAVDAAAPWWKTASFYQIYPRSFKDSDGNGVGDLN
GVTEKLEYLKEIGVTATWLSPFLKSPMADFGYDISDFKAVDPLFGTMEDF
ENMVSRAKELGVKIILDFVPNHSSDECDWFLRSAAGEEEYKDYYMWHPGF
LDEDGTRRPPTNWVSVFRGSAWEWHEGRQEYYLHQFHKKQPDFNFRNPVV
REEMNNVLRFWLEKGVDGFRVDAIYHAFEIEADENGNYPDEPRNDWTNDP
DEYGYTHKIYTVDQPETPHLVYEWRQILEQFQADNGGDERILMVETWSPI
EIVMHYYGNETADGAQIPFNFQLISNLHYDSDAYHYEYLINNWLNLMPEG
KSANWVIGNHDKNRVGSRFGADRVDLFNILLLTLPGCSITYQGEELGMLD
GYVSWEDTVDPQACNGYEANYMDNSRDPARTPMHWSDETMAGFTTGNSTW
LPVSTDYRQRNVKTERGVSLSHLNVFKRLQQLRQEPSIEEGSAEVKAVSN
YVLAVKRHLSGDFVYISLFNIFDSIENVNLSSVFGSLPAKFQYALVTEKS
IKKVGDQVSAGSVTLMPHESIVLRSTTTAASFLDH

BO28226.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A4-PA 579 CG8693-PA 1..579 1..579 3137 100 Plus
Mal-A3-PA 574 CG8695-PA 7..571 7..573 1923 60.1 Plus
Mal-A5-PA 630 CG30359-PA 44..602 24..582 1902 60.7 Plus
Mal-A5-PC 611 CG30359-PC 44..583 24..582 1819 58.8 Plus
Mal-A5-PB 534 CG30359-PB 1..506 77..582 1663 59.2 Plus