Clone BO28241 Report

Search the DGRC for BO28241

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:282
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptCG6688-RA
Protein status:BO28241.pep: Imported from assembly
Sequenced Size:1306

Clone Sequence Records

BO28241.complete Sequence

1306 bp assembled on 2011-07-19

GenBank Submission: KX794929

> BO28241.complete
GAAGTTATCAGTCGACATGAGGAAATCAGCGGGAGGATTTCATTCCACAT
CCAATGAAGATGGGCAGCATGGCGATGGCTCCTCCGTGCGACTACTGAGA
ATTCCCAGAGCCGCACCTGCGATGGAGAACTACGGATTTCAGCTGACCCG
CAGCAAATGGGATCCCTATCCCTGGGTTTGCGAAGTGGCAGCCGGCACAC
CTGCCGCTCTCTGCGGCCTGAAACCCGGCGATTGCGTTCTGGAGGTAAAT
GGCAACGATGTTTTAGGCTTGAGAGTGTCTGAAATCGCCAAAATGGTGAA
GAGTCAAAAGGACTGCGTCACAATTCTCTGTTGGAACAGTGAATGTGATA
AGGACTGTGATACTAATAGCATCTGCTGCGCCCCCATGCCCACCAGTTTG
CGCCGCCTGTCCCTCGTCCTGGAGAGCATCCTGCGCCTCGTCGAGTGTCC
TGTCTGCGGGGTGACCATCTCACCGCCGGCGATGCAGTGCCAAAACGGAC
ACCTGCTCTGCGTGGACTGTCGCATCCGCTCGGAGCGATGTCCTGTCTGC
CGGGACTTCTACACTCCCCGCCGAGCGCTGTTGGCGGAGCAAATTTTCCT
GACCATTGCCAACGCCTTCGAGATGTGCCGCTCGGAGAACAAGCTGCGGC
AGAAGCTCTTTGCCGGGATAACACGGCCAGTCGTGGGCCGACAGGACAGG
ATAACCGGACAGGACACCTGGCGAAAGCGCAGGCCAGTGCTGCCAACGAA
CAAGTTCCTAACCAAGTTGCTTGAGGGCTGCGCCTACTCGACGGATAACC
TCAGTCCCTCGAATGCCGCTACTCTGCTGCGGACTAATACCACGGACGTC
GCTGGCGACTCCAGTGAAATCCCGGCCAGAACATCGCCAGTGACAGCCAC
GCCCCCCGAAAGGACAACAATGCATGCCACGCTTGACGCGAATGCGGCGC
ATCCTTCACTCTCGACGAATGATTTACAGCAGGAAGGAGTTAAGCCGAAT
GCCGAGGGCGTTGACGAGGAATCCGGAACGAACAGCAGCCACATCTCTGC
CACATCCTTGCATGGCCCTCCGCTACCAGCCTCCGTTAGCCCGGGCATCA
ATGAATCTTCCGGATTGCAACCCGTTCGCATACCTCCTGTCACTCCAAGC
CAAGATTTGCCCCAGCAGGTTGTCCAAACTAAGCCGGCCTCGCTGTTGTA
CCGCTGTCCCTGCAAGCTGCAGGATCCACAGGATCCTGCAAAGGACCTCC
ACCAGAACTGCTGCTACAAATCCGCTTTCCGTCTGCTTGCAAGCTTTCTA
GACCAT

BO28241.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-RA 1275 CG6688-PA 1..1272 17..1288 6360 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-RA 1778 CG6688-RA 103..1374 17..1288 6360 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23014151..23015071 368..1288 4605 100 Plus
3R 32079331 3R 23012514..23012674 17..177 805 100 Plus
3R 32079331 3R 23013914..23014038 243..367 625 100 Plus
3R 32079331 3R 23012741..23012812 175..246 360 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:56:04 has no hits.

BO28241.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-19 10:35:36 Download gff for BO28241.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 103..1374 17..1290 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:41:15 Download gff for BO28241.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 103..1374 17..1290 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:46:13 Download gff for BO28241.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 103..1374 17..1290 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:46:13 Download gff for BO28241.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23014151..23015071 368..1290 99   Plus
3R 23013916..23014038 245..367 100 -> Plus
3R 23012742..23012810 176..244 100 -> Plus
3R 23012514..23012672 17..175 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:41:15 Download gff for BO28241.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18839873..18840793 368..1290 99   Plus
arm_3R 18839638..18839760 245..367 100 -> Plus
arm_3R 18838464..18838532 176..244 100 -> Plus
arm_3R 18838236..18838394 17..175 100 -> Plus

BO28241.pep Sequence

Translation from 16 to 1306

> BO28241.pep
MRKSAGGFHSTSNEDGQHGDGSSVRLLRIPRAAPAMENYGFQLTRSKWDP
YPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDC
VTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVT
ISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIANA
FEMCRSENKLRQKLFAGITRPVVGRQDRITGQDTWRKRRPVLPTNKFLTK
LLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVTATPPERT
TMHATLDANAAHPSLSTNDLQQEGVKPNAEGVDEESGTNSSHISATSLHG
PPLPASVSPGINESSGLQPVRIPPVTPSQDLPQQVVQTKPASLLYRCPCK
LQDPQDPAKDLHQNCCYKSAFRLLASFLDH

BO28241.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-PA 424 CG6688-PA 1..424 1..424 2262 100 Plus
CG34375-PA 567 CG34375-PA 16..187 40..201 334 40.7 Plus
CG34375-PC 568 CG34375-PC 16..188 40..201 334 40.5 Plus
CG34375-PB 568 CG34375-PB 16..188 40..201 334 40.5 Plus
sinah-PC 351 CG13030-PC 100..155 138..193 155 50 Plus