Clone BO28246 Report

Search the DGRC for BO28246

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:282
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG9203-RA
Protein status:BO28246.pep: Imported from assembly
Sequenced Size:2206

Clone Sequence Records

BO28246.complete Sequence

2206 bp assembled on 2011-07-18

GenBank Submission: KX794701

> BO28246.complete
GAAGTTATCAGTCGACATGTCAGATGCAGACTACTTGTTCGCTCTGAACC
TGCAGAACCAGCTAAATGCGGAGTCAGACCAAAGTTACACAGCCGCGGAT
GCCAGCAATGACAGGGACTATCAGCTGGCACGCAGGATTCAGAACCTAAT
AAACGAGGGCGATGAGGACGGTGCTAGCGAGCTGGACAGCAGCATTCAGT
TCGTCTACCCCAAATCGAATCAGCCAAAATCAACAAAAATGGAGAACTCT
GAAATCAAAAACAAAAAACGAGAAGCGGCTAAAAAGAAGCCAGTGCGCGC
TATTCAGGCCAGCCATGATGACTATCTGAATAAGACGATGAATCTGGTGG
ATCCGGAGTGGGAGCTGGTCGATCCCACCCCGGACATCTACGCCATGTTC
ATACGCTTCGACGAGAAGTTCTTCCAGGAGCGCCTGGGCGCCGTCTCCCT
GGAATGGAGCAAGAAGATGTACTCGTGCGCTGGAATCTGCTACCAGCGTG
GCAATCGCTTCGTCAAACAGGTGACCATTCGGCTCAGTGAGCCGCTGCTA
AAGTTGCGTCCGCGCAAGGATCTCGTGGAAACGCTCTTGCACGAAATGAT
CCATGCCTACTGCTTTGTGCTCAATATACGCGAGGGTAACGGTGGCCATG
GACCCAATTTCAAGCGCATCATGGAGACGATCAATAAGGTGGCGGGCACC
AACATCACCGTTTACCACACTTTTCACGATGAGGTGGCCTCCTATCGCAC
CCACATCTGGCGCTGCACGGGCATTTGCCGAGAGCGCTCACCCTTTTGGG
GCTATGTGAAGCGGACCAGCAACCGAGCGCCCGGTCCGAACGATCAGTGG
TGGAAGATGCATCAACGTGAGTGCAGCGGCACCTTTTTGAAGTTGAGTGA
ACCCCCGAAGGCCCCCAAGCCGGAGACCAAGTCAAGGGCTAAGAAGTCCA
CACCGGCGGTGGCCGCGCCCAAGGAAGACATACGCAACTGGTTCGGCCAG
CCGTCAGCCAAGAAAGCGGCCACCGGCACAGTCTTACTAGGCGATCTGGC
GAAGGCGGTGCCGCCGACTTCTTATCCCGGACTCTCTTCCGAACCCTTTG
CATTGCCCAAGACACCAGCTGCTGGCACAAAAGGCAACAAAAGCGGCGGA
TTCAATGAACTGGACAAATCAGGTTCGAAAGCCACCACTGAAATGAGCGG
ACAGGGCTACAGTCTTGGTGGCTCTAGCGCTATAGAACACATAGATCTTA
GTGACACTGATGTTCCCGATTCCGCTAAACTTCGTCAAATTCGACTTCAG
CGTTTTAGCGAAGATGCTTCCAACAAGCGACAGAATAAGAAAAAGAGGCG
TCGTGTTTCCAGCGACAGCGAGATAATCAACTGGGAGTCCTACGATGATG
ACGTAATGGTCAGGGATGTTCATACGCCCATCGTCAACTTGGTCGAAAGC
TCTAGTGATGAAGAGGAGATGAAGATGCCAGCTGGCAGAAAAACCATGAC
CAGTCAGGAGCGCACGCAGATCATCAAGCGCCAGGTAATGGAGGATGAGT
TGACCTTGTGTGAGGACGATATCCTCTTAATTGATGATGAATACGACGAT
GAGGTGGCCGCAAATGAATCTTTAACAGCCGCCACGGAGCTAGCTGACCA
ATCCATTATAGATGATATTTTTGGAGAGGACACCCTGCTGAAGGAGTTCC
AGCGTGAGAACGACGTGCAGCCCAGTTGCTCAAGCTACGCCAAAAGAATT
GAGAACGACATCGTATCTTGTCCCATTTGCTTTGAGAAAATGAGGCGCAC
TGAGTTGTCCAATCACTTCGATGGCTGCGCCATTATGGTGCGCTTGGAAC
CGCCATCGTTTAAGCCTAAAAACCGCCGAACAACTGCTTCCTTAACCTCA
AAGGACTCGTCGGGAGCTTCCACATCACGCCGCGCTAAATCGAAAGCAAA
GTCATCAAAAGGAATTCTTCGCAGCTCCGGTTACACAGAAGGGGAGATCG
ACAAGCTCAACCTGAGCTCCTCTACCGACTCGTCTACTCTGCCGTCTAGC
GAGGACGAACTTACTCCGCGTCAGCGCCGCCAGCGCAACCTCTTCAAAGA
GACCGTAGGCTGCCCCAGATGTGGCCTGGAGATCATGCCTCTACACCTGA
AGGTCCATGGATCCGTCTGCGCTGGTCGCAAGAAGCGCGCAAGCTTTCTA
GACCAT

BO28246.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-RA 2175 CG9203-PA 1..2172 17..2188 10860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-RA 2349 CG9203-RA 84..2256 16..2188 10865 100 Plus
tkv-RC 2885 CG14026-RC 37..160 2186..2063 260 80.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15472897..15474496 2188..589 8000 100 Minus
X 23542271 X 15474603..15474959 589..233 1785 100 Minus
X 23542271 X 15475039..15475161 232..110 615 100 Minus
2L 23513712 2L 5243488..5243738 1472..1733 525 81.7 Plus
X 23542271 X 15475223..15475317 110..16 475 100 Minus
2L 23513712 2L 5243945..5244103 2028..2186 390 83 Plus
2L 23513712 2L 5243850..5243933 1906..1989 285 89.3 Plus
2L 23513712 2L 5243740..5243784 1754..1798 210 97.8 Plus
Blast to na_te.dros performed on 2014-11-26 21:40:29 has no hits.

BO28246.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:48 Download gff for BO28246.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 62..2233 17..2190 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:33:18 Download gff for BO28246.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 85..2256 17..2190 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:15 Download gff for BO28246.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 85..2256 17..2190 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:15 Download gff for BO28246.complete
Subject Subject Range Query Range Percent Splice Strand
X 15475224..15475316 17..109 100   Minus
X 15475039..15475161 110..232 100 <- Minus
X 15474603..15474959 233..589 100 <- Minus
X 15472895..15474495 590..2190 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:33:18 Download gff for BO28246.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15369257..15369349 17..109 100   Minus
arm_X 15369072..15369194 110..232 100 <- Minus
arm_X 15368636..15368992 233..589 100 <- Minus
arm_X 15366928..15368528 590..2190 99 <- Minus

BO28246.pep Sequence

Translation from 16 to 2206

> BO28246.pep
MSDADYLFALNLQNQLNAESDQSYTAADASNDRDYQLARRIQNLINEGDE
DGASELDSSIQFVYPKSNQPKSTKMENSEIKNKKREAAKKKPVRAIQASH
DDYLNKTMNLVDPEWELVDPTPDIYAMFIRFDEKFFQERLGAVSLEWSKK
MYSCAGICYQRGNRFVKQVTIRLSEPLLKLRPRKDLVETLLHEMIHAYCF
VLNIREGNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRTHIWRC
TGICRERSPFWGYVKRTSNRAPGPNDQWWKMHQRECSGTFLKLSEPPKAP
KPETKSRAKKSTPAVAAPKEDIRNWFGQPSAKKAATGTVLLGDLAKAVPP
TSYPGLSSEPFALPKTPAAGTKGNKSGGFNELDKSGSKATTEMSGQGYSL
GGSSAIEHIDLSDTDVPDSAKLRQIRLQRFSEDASNKRQNKKKRRRVSSD
SEIINWESYDDDVMVRDVHTPIVNLVESSSDEEEMKMPAGRKTMTSQERT
QIIKRQVMEDELTLCEDDILLIDDEYDDEVAANESLTAATELADQSIIDD
IFGEDTLLKEFQRENDVQPSCSSYAKRIENDIVSCPICFEKMRRTELSNH
FDGCAIMVRLEPPSFKPKNRRTTASLTSKDSSGASTSRRAKSKAKSSKGI
LRSSGYTEGEIDKLNLSSSTDSSTLPSSEDELTPRQRRQRNLFKETVGCP
RCGLEIMPLHLKVHGSVCAGRKKRASFLDH

BO28246.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-PA 724 CG9203-PA 1..724 1..724 3774 100 Plus