Clone BO28296 Report

Search the DGRC for BO28296

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:282
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptCG43089-RA
Protein status:BO28296.pep: Imported from assembly
Sequenced Size:466

Clone Sequence Records

BO28296.complete Sequence

466 bp assembled on 2011-09-14

GenBank Submission: KX795161

> BO28296.complete
GAAGTTATCAGTCGACATGTCGTCCTCTTCTTCAGAAGCAATTCAACTTC
AGACCAACGATGGTGTCATTCATACAGTGGACATGCGCTTTGCTCTACAG
ATATGCCCCGTGCGCAATATGATAATGCAGGAGAGACAGAAAAATTTGCA
CACCGATGATGTTATCCCTCTACCGAGAGTCGATGCCAAAAACCTTCGAT
TTATAATCAAGTGGTGGACATCTGTGCAGAATCTAGATGAAAATCTTCTC
ACTATGGGCAAAAGAAAACTTAAGCAGTTGCTAACGGCGGAACATGCCAA
CCATCAGTTTCTGCTGCAAATCATCCTTGCCGCCGACTATCTGCAAATGG
AGAAATTTTTGCTGATCAGCACACATCTCATGGCGGATGCTTTAAATGAA
TGTGAAAGTGTCGAAGAGATACGTAGAAAGTTTTTTTGGAATAAAGTGGC
AAGCTTTCTAGACCAT

BO28296.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG43089-RB 435 CG43089-PB 1..432 17..448 2160 100 Plus
CG43089-RC 435 CG43089-PC 1..432 17..448 2160 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG43089-RB 499 CG43089-RB 54..485 17..448 2160 100 Plus
CG43089-RC 638 CG43089-RC 54..485 17..448 2160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3714133..3714564 17..448 2160 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:13:27 has no hits.

BO28296.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:12 Download gff for BO28296.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RA 80..511 17..450 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:13 Download gff for BO28296.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RC 54..485 17..450 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:06:05 Download gff for BO28296.complete
Subject Subject Range Query Range Percent Splice Strand
CG43089-RC 54..485 17..450 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:06:05 Download gff for BO28296.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3714133..3714564 17..450 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:13 Download gff for BO28296.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3714133..3714564 17..450 99   Plus

BO28296.pep Sequence

Translation from 16 to 466

> BO28296.pep
MSSSSSEAIQLQTNDGVIHTVDMRFALQICPVRNMIMQERQKNLHTDDVI
PLPRVDAKNLRFIIKWWTSVQNLDENLLTMGKRKLKQLLTAEHANHQFLL
QIILAADYLQMEKFLLISTHLMADALNECESVEEIRRKFFWNKVASFLDH

BO28296.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG43089-PB 144 CG43089-PB 1..144 1..144 739 100 Plus
CG43089-PC 144 CG43089-PC 1..144 1..144 739 100 Plus