Clone BO28308 Report

Search the DGRC for BO28308

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG8851-RA
Protein status:BO28308.pep: Imported from assembly
Sequenced Size:1966

Clone Sequence Records

BO28308.complete Sequence

1966 bp assembled on 2011-07-19

GenBank Submission: KX794112

> BO28308.complete
GAAGTTATCAGTCGACATGTTAAAGCCATCCAGGCGACCATTAGCCAACA
GACAACGATCACTTCGATTCCGTCCACAGAATCGCAAAGGAACATCATCT
AGTAACACCTCAATGGGACTGGACTTCGAGCTGGATGAGAAGAACGAAGA
TCAGGCAGATGAAAATGAAAAGAGTAGCTATGTCAGCCTCTCCAGGCCGA
GCTCCAAAGTACTAGATACGAGAAGTGCCAGTAGCTTGGACTTCGGGGAC
CACTGTAGTCCCAGTATAACAAAATTACCCAAGAACAGCAGGGAAGGTAA
GGAGGTCAGCCTAATCATGAGTGATGAAGAGCCGGAAGATTACAGAAAGG
GTCTGGGCTCGAAGAGGAGGTTGCCAGACTCGGAAGCCCTTGGCAGCAAG
CTAAAGGAGGAACTCTGCAAGTACAAGCAGGAGCTCAAGGACTACAACGA
AAGCACCAAGGATCTGGAGGAGAAGTACATGAAAATTAACTACGAGCTGT
GCGAAATGCAGCAGAAGCACGATCAGTTCGTGTCCAGCAGGAAGCAGGCC
CAGCAAATGGATCTGGGAAGTGAGCCCGATCCGGATGGATTTTATAGCTC
TGCCAGCAGTGTCACCTCGCAGACGACCATCAGACGAAAGAGCCCCCAAA
TCCTGCGCAGCAATACCAGTTTCATGACCGTTCTATCGGGCCAGAGTTCC
TGCGACGAAATCGATAGAAAGAAATACGCGTCCGAAAGGAGTACTCATCA
GCAGAATCACCATCGGCACAAGGACGATCTGCCATCACAGGTGAACAGCG
TTTTTGACAGCCGTATTGTGGAAACACTGGCGAACCGTCACGTGAAGCGC
AGGAAGAGATCCTTGGAGCAGGACGATCGGGAAAGGGAGCCAGCATCCTT
CAAGGATGTGTACAATGTGCTGAAGGATGTGATCAACACCTCACAGGATC
AGAAGTACAAGCATGAACGGGATCGAGGTAGGGACAGAGACAGGGACAGG
GACTCTGGAGATATAAGCCAGCTCCTTACCACCATTAAGGGACTGAAGAG
CGAGCAGGTCCAGTTTCGAACTCTCATTCGGCAGCAGCAGGAGAGAATAT
CGGACTACCACACGCGGTGTGTGAAAGCCCAGGACATCATGAGCACCCAG
AAGCAGGAGATCGAGAAGCTGCACGTGAATAACAAGCAGTTGGAGTCGAG
CATCTACCATGACATAGACAGTCTGCGATCCAAGATAGACAACAAACTGA
AAAGTGTCTCCCATTTGCCGAAGATGATGCGAGACGAGCACTCCAAGTAC
GAGACGGTAATGCGGGAAAATTGTCTGCTGGCGGATAAACTTCATGCCCT
CCAACAGGAAGCCATGCAGCTGAAGGTCAAAATAGATGAACTGGGCCGTC
GAAAGTTGGTCACCATCAACCGGCTGAAGGCCGCCGAAAGGGATCTGAAG
ATCTTTAAGAACTACAACTCGGCCTTGAAGACGGAGAAGCGGAAACTGAC
CCAGGAGCTGTCCACCATGAAGGATCAGCTGGAGCAGCTCCAGGCGAGCA
GCAAAAGGCAACTTTCCCGCCATCGCGAGCAGAGCGAAAAGCAGCGCAGG
GATCTGCAGAAGAAGATCTACGACCTCGAACTGAAGCTGAGTAGGAGCCA
AAACTCGACGTCCAGTTTGATCCAGGAACGGGATAGTCTGATAGCTGAGC
TCCAGACGCAACTCCACACCCTGGTCCACAACTTCGAGGTCTCGCAGAAA
CACATAAGGGTTCTCCGGCGGCACATCTACTCCATGACGAATCAGGGTGG
CACGGGCATCGTTGGCAGTGGGTCGGCTGGCATTGCCCACTTGACATCAG
GTGGTTCCCATCGACCCAGTCTGATCAGGATCAATCAGCTGCCCCAGGGA
ACCAGCAACGGTCGATTTGCAGCCCCCCGAACTCTAAAGGCGACGATCGC
AAGCTTTCTAGACCAT

BO28308.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-RC 2172 CG8851-PC 238..2169 17..1948 9615 99.8 Plus
CG8851-RA 1935 CG8851-PA 1..1932 17..1948 9615 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-RC 2390 CG8851-RC 273..2204 17..1948 9615 99.8 Plus
CG8851-RA 2275 CG8851-RA 158..2089 17..1948 9615 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3521365..3522369 944..1948 4995 99.8 Plus
2L 23513712 2L 3520379..3521309 17..947 4640 99.9 Plus
Blast to na_te.dros performed on 2014-11-26 22:01:43 has no hits.

BO28308.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-19 12:48:25 Download gff for BO28308.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 123..2049 22..1950 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:44:17 Download gff for BO28308.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 163..2089 22..1950 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:49:03 Download gff for BO28308.complete
Subject Subject Range Query Range Percent Splice Strand
CG8851-RA 163..2089 22..1950 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:49:03 Download gff for BO28308.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3521368..3522369 947..1950 99   Plus
2L 3520384..3521308 22..946 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:44:17 Download gff for BO28308.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3521368..3522369 947..1950 99   Plus
arm_2L 3520384..3521308 22..946 99 -> Plus

BO28308.pep Sequence

Translation from 16 to 1966

> BO28308.pep
MLKPSRRPLANRQRSLRFRPQNRKGTSSSNTSMGLDFELDEKNEDQADEN
EKSSYVSLSRPSSKVLDTRSASSLDFGDHCSPSITKLPKNSREGKEVSLI
MSDEEPEDYRKGLGSKRRLPDSEALGSKLKEELCKYKQELKDYNESTKDL
EEKYMKINYELCEMQQKHDQFVSSRKQAQQMDLGSEPDPDGFYSSASSVT
SQTTIRRKSPQILRSNTSFMTVLSGQSSCDEIDRKKYASERSTHQQNHHR
HKDDLPSQVNSVFDSRIVETLANRHVKRRKRSLEQDDREREPASFKDVYN
VLKDVINTSQDQKYKHERDRGRDRDRDRDSGDISQLLTTIKGLKSEQVQF
RTLIRQQQERISDYHTRCVKAQDIMSTQKQEIEKLHVNNKQLESSIYHDI
DSLRSKIDNKLKSVSHLPKMMRDEHSKYETVMRENCLLADKLHALQQEAM
QLKVKIDELGRRKLVTINRLKAAERDLKIFKNYNSALKTEKRKLTQELST
MKDQLEQLQASSKRQLSRHREQSEKQRRDLQKKIYDLELKLSRSQNSTSS
LIQERDSLIAELQTQLHTLVHNFEVSQKHIRVLRRHIYSMTNQGGTGIVG
SGSAGIAHLTSGGSHRPSLIRINQLPQGTSNGRFAAPRTLKATIASFLDH

BO28308.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8851-PC 723 CG8851-PC 80..723 1..644 3262 100 Plus
CG8851-PA 644 CG8851-PA 1..644 1..644 3262 100 Plus
CG3213-PA 676 CG3213-PA 403..669 325..593 342 26.8 Plus
zip-PH 1964 CG15792-PH 1125..1660 96..587 164 20 Plus
zip-PG 1971 CG15792-PG 1117..1652 96..587 164 20 Plus