Clone BO28325 Report

Search the DGRC for BO28325

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:25
Vector:pDNR-Dual
Associated Gene/Transcriptalpha-Est6-RA
Protein status:BO28325.pep: Imported from assembly
Sequenced Size:1738

Clone Sequence Records

BO28325.complete Sequence

1738 bp assembled on 2011-07-18

GenBank Submission: KX794506

> BO28325.complete
GAAGTTATCAGTCGACATGTGGAAACTCTGTCAGCCGAGAAGTCGAAGTC
GGATCAAATGTTTCAGATTCCTAATCCTGCGTTGTTGTCCCGGATTCAAG
AGATTCTCGTGCCAATCAGCAGGTGATGCAGACTCCAAAGTCGTCAAGCT
ATCAGTAGGGAGTGTCAAGGGTCGTCGACTGAGCGGTATCTATGGTGACG
AGTTCTACAGCTTCGAGGGAATTCCCTTTGCCAAGCCGCCGCTAGGGAAA
GCCCGATTTGTGGCCTCCCAATTGGCAGACCCATGGAATTCAGAGCTCGA
TGCTCGGCAGGAGAGACCGATTCCTCTGCAGATGGACAGAAGGTCGGGAA
AGGTCGTTGGCAGTGAGGATTGCCTGTACTTAAACGTATACACCAAGCAT
TTTAACGAATCTGAGCCACCTCTGCCCGTAATGGTGTATATCTACGGCGG
TGCCTTTCGCACAGGCGGAGCTGTGAAGAGCAAATACGGGCCGGATTACT
TGATGAGCAGGGATGTTGTATATGTGCTATTCAACTATCGCCTCTGCTCC
CTGGGATTCCTTAGTATGCCCAGTGGCAAGTTGGATGTGCCGGGCAATGC
GGGTCTCCATGATCAGTTACTAGCCCTTCAATGGGTTAGCCAGCACATAC
GGAACTTCAACGGAGATCCGCAGAATATAACGCTTTTTGGCGAAAGTGCG
GGGGCCGCCTCGGTGCACTTTATGATGTGTCTGCCGCAGGCGAAGGGTCT
CTTCCACAAGGCCATCATGATGTCCGGATCGATGCTGAGTCCCTGGGTGA
ATGCTCCCGATAGCGATGGTATATTCTGCCGCCTGGCCACGTCTGCAGGA
TACGAAGGACCCGCGGAAGAGGTCCCCATTTTGGAGTTTCTGCGCAACGT
GAATGCCGAAAAACTCATCGGCCACGATTTCATCTCACCCCGTGACCGTT
GCTTTGGGTTTCTTAACCCATTTGCTCCAGTTGTTGGAGGCCTGGTTGCA
GCCCCGTTTCAGCAGCTGATGAAGGAGGCGTGGTCCTGTGAAGTGCCCCT
CCTCTTGGGTGGCACTTCCTTCGAGGGACTGGTGTACTACCCATTCTGTC
AGCTGGATAATGGCTATATGCTGGAGCTGCTGAAACATGAACCAGCGATG
GTATTACCCCACGAGCTATATCAGTCGATGAGCGTCGAGGAGCGGAACAC
AGCGGCCGATGTCCTCGTTAAGTATCACTATGGACCGCGCGGTATCACCA
AGAGTAACATCACACAGATTCTAGATCTTTTCAGTTACAAGTTATTCTGG
CACGGCATACATAGGGTGGTCCTCTCCAGATTATCTCACGCACAAGCACC
TACCTATCTGTACCGGTTCGACTTCGATTCGCCCAAGTTGAATCTGATGA
GGAACCAGCTCTGCGGCGATGACATCAAACGCGGTGTTTGTCATGCGGAT
GACTTGGGCTACATTTTCCACAAGCAGGCCCAAGCGAAGCAGCCCCTTGA
CTCCCCGGAGTTCCTGACCATCCAGCGTATGGTGGGCATATTGACCACGT
TTGCCAGGACCGGCGATCCCAATTGTCCGGAGACGGGTCCGGATCCGTGG
ATGCCCGTCTCCACAAAGTCTCCCTTCAAGGCATTGAATATTGGACAGCA
GGTGGAGTGTGTAACGCAGGTCGAAAAGGACGGTCTGAAGGTGTGGAATC
GGCTATATAGTGACTTAAAAGCAAGCTTTCTAGACCAT

BO28325.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-RA 1707 CG1108-PA 1..1704 17..1720 8505 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-RA 1836 CG1108-RA 58..1764 14..1720 8520 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7525175..7526050 1276..401 4380 100 Minus
3R 32079331 3R 7524639..7525089 1720..1270 2210 99.3 Minus
3R 32079331 3R 7528334..7528720 400..14 1935 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:40:54 has no hits.

BO28325.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:49 Download gff for BO28325.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 61..1760 17..1716 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:33:31 Download gff for BO28325.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 61..1760 17..1716 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:27 Download gff for BO28325.complete
Subject Subject Range Query Range Percent Splice Strand
alpha-Est6-RA 61..1760 17..1716 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:27 Download gff for BO28325.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7528334..7528717 17..400 100   Minus
3R 7525175..7526050 401..1276 100 <- Minus
3R 7524643..7525082 1277..1716 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:33:31 Download gff for BO28325.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3354056..3354439 17..400 100   Minus
arm_3R 3350897..3351772 401..1276 100 <- Minus
arm_3R 3350365..3350804 1277..1716 99 <- Minus

BO28325.pep Sequence

Translation from 16 to 1738

> BO28325.pep
MWKLCQPRSRSRIKCFRFLILRCCPGFKRFSCQSAGDADSKVVKLSVGSV
KGRRLSGIYGDEFYSFEGIPFAKPPLGKARFVASQLADPWNSELDARQER
PIPLQMDRRSGKVVGSEDCLYLNVYTKHFNESEPPLPVMVYIYGGAFRTG
GAVKSKYGPDYLMSRDVVYVLFNYRLCSLGFLSMPSGKLDVPGNAGLHDQ
LLALQWVSQHIRNFNGDPQNITLFGESAGAASVHFMMCLPQAKGLFHKAI
MMSGSMLSPWVNAPDSDGIFCRLATSAGYEGPAEEVPILEFLRNVNAEKL
IGHDFISPRDRCFGFLNPFAPVVGGLVAAPFQQLMKEAWSCEVPLLLGGT
SFEGLVYYPFCQLDNGYMLELLKHEPAMVLPHELYQSMSVEERNTAADVL
VKYHYGPRGITKSNITQILDLFSYKLFWHGIHRVVLSRLSHAQAPTYLYR
FDFDSPKLNLMRNQLCGDDIKRGVCHADDLGYIFHKQAQAKQPLDSPEFL
TIQRMVGILTTFARTGDPNCPETGPDPWMPVSTKSPFKALNIGQQVECVT
QVEKDGLKVWNRLYSDLKASFLDH

BO28325.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
alpha-Est6-PA 568 CG1108-PA 1..568 1..568 3048 100 Plus
alpha-Est5-PA 542 CG1089-PA 14..536 45..564 1228 46.8 Plus
alpha-Est5-PB 543 CG1089-PB 15..537 45..564 1228 46.8 Plus
alpha-Est1-PA 565 CG1031-PA 28..559 36..564 1112 44.5 Plus
alpha-Est2-PB 566 CG2505-PB 34..560 42..564 1090 43.7 Plus