Clone BO28347 Report

Search the DGRC for BO28347

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG15143-RA
Protein status:BO28347.pep: Imported from assembly
Sequenced Size:3490

Clone Sequence Records

BO28347.complete Sequence

3490 bp assembled on 2011-07-18

GenBank Submission: KX794149

> BO28347.complete
GAAGTTATCAGTCGACATGTCCAAACACAATACACGACTCGATAGGCATG
TTAAGTTTAGGATTCTTCAGGAGGACAGGTTACAATCACCGAGACAAAAA
GAGGATAATATCAAACGGAAAAAGAGCACTTCCAAATCTGAAAATCTTAC
TGAACGTGGCCTATCATCTTGTCTGATCAACAGCTCGGTAGATCTGCGGA
TCACAGGAGGTGAGAATGACCCAGCACAGCGCAATGTTGGAAAATTGCCT
CGCACCGACAGCGAGTGTCAGTTCAAAGCTCCGGGATACCGATTTCTTAC
CGAACAAGATACTACAGTGAACACCCATGAGGTCAAGATGAGCCCCAGGG
TAGTGACGAAAAAGGATTTAAGGCACAAATGTGATTTCTTTGCTAAGAAC
AAGGACGCACGACCGTTTAAGAATAAGATCACGCAGACGCTTTACAGAGA
ATCCTCTGCGCAGACAATGGCTTATTTGCCGGAGATTTTTGAAGCAAACA
GCGTTGAAACCTTGGAACTGTTTTCCCTGCCATCTATATTCCCAGTAGCA
AATCGACCGGGACTCCATGAAGTTGAGATTCTGGAACGCGCCAGGAAACG
ATGGGCCTTTAGTGATGCCCTAAAGATTCACTTCAAAAACCTACTTCAAG
ACGCCAGGAAAGTGGCGATAAAAACAGAGCTCAAGGAGATTTTGGAGGCC
ATTGAATGGGAGCAGTGGATACAGCGTGAGGAGGACATTCAAGAGTGCCA
GATGATGCGTCTCCAGATCGTGATTAAAATGTTTGATAAGCGGGAGAAGG
AGATGCACACCGCTTCAAAGACTCGAATCGAAACAGCCTGCGAGCGAATC
GAGAAGCGACGTCAGGCGGGTTTGCGAAAAAACGAGATCGAGTTCCAACG
GGGAATGCGCCGAATGGAGTTCCAACTTACGAAGAATCCGCGAAGGTGGG
AGAAGCAAAGTCCCATGTACGCGTTGGGATCACCCAGCTCGGAGTTCTAC
GCTCCGCTTTTAAGATACGGCGTGGATCCGGCGCGTCGCAACTTTGTGTC
CAAAACAGCACAAAAAGCCTTCGATATGAGAATCGATGACTTAGAGAAGC
GAATCAACAATACCGACTTCAAATGTCCGTTTAGAAAGCTTAAGGATTGG
TCCAAGCCCAAAAAGTATGACAAGGAATATGAGCGGAACTTCTGCAAGGA
AGACAATCTACAAAAGCTCTTCGAATCTCTGAAAGGCCTAAGAACACAGG
CCAATGCGGAGAGAGAAGAACCAAAATGTCTAGTACGGCGAAGAAAACCC
GAATTGGGTAGAGCGGCATCCCAAATAACCCTGGCCTATCTAACTGACTT
GTACGAAAGGAGCGATTCTGATGAGGAATATCGTAAATCGCGAGCTTACG
GATCCTTTTCACCACACGCAAAGCCGGGGACGAACAAAGTCTCAGAGACC
ACACTATCGCATTTGAAGAACGACAGGAAGCGCGAAGAAATGGAGCACAT
GTTGAACATTTATGAGGGCACCTACGTGGGTTGGGTGATGCAGTTCCTCT
CGGAGGAGATGACCCGACTTTCGGAGCTGCGAAGGCTTCACTTCTTCTCG
ATTATGGCCCAAAAGGAACGCTGGAGACGCGAGGCCGCCGAAGCCGGTCT
GCGACAGAAGGAGAACGAATTGAGATTGTTGTACGAGGAGCTTTTCCAAC
ATTGCAATGTGGTCAACAATGAGATCTCCAATAAGTATTTTGCCAACATT
CTGAGCTCTGATATGTACGGCATGGCCGATGGCCTTGCTGGCGAGACAGT
GAGTGAATTGGCCAAAAAGATCGATGCGGATATATTGCGATGGCTAGAGA
GCTTTAAGTTGATCCAAAACCCCCTTACCTATGTGCCACTACGAATAATG
TTGAATGACATGATTTCACCGAATATGAACAATATTCTGCAGCGCTACGA
GAATTCCCTGATCGCCCAGTACGTATTGGAGGATGTGATTTTCCCAAAGG
TGTGGAATGAACTAGATCCGTTTGATATAGGATGTACTTTAACGAGTGAT
CTCATAGATCGCCTAATCGACAACGATTTGTATCTGATGTCCACTGACAG
CGAAAGTGAAACCCCACAAAAAACTTCCTGGCGCGAAGCTCATGCCATCA
TAAGAAAGATCATACGACAGGCAGTTCCTGGCGATCGTTGGCTTCAAGAA
AATGAGCGTATTGTTAACGAAAACTATAATGATCTATTTGACGACGTGTT
CGCAGGCATATTTGACAAGTCTGAAAATCCTCCAGCCGTGAGGCCATCAC
AACTAATCGAGCTCTGCCCTACTGTCTCTCATAATTACATTCATCACATG
GACAATATACGCGAGATGGAAAACTTTCATACCGAAAATGCTACCTCACA
GCCAGGATCAGAATTTGAAAAAAAACAGTTGTTAAACATATTAAGAAAAC
GCAAAGAAGACAATATTACAAGAAATTTACAAAACTTTGATAATCCCCTG
GCGGGTGAAATACCATCTGACAGCGACATATTTCTAAGATCTCAAATATT
CAATCCAATGCCACTTCCAACGACGACACCAAGTGATTTGTTCAGTCTTA
GAAGCACTCTCGATGTTTCGCATGCCTCAAAATTGGGATCATTTGTCGGC
AGGGGCTATAGAGTAATGCTTCCCAGTGAGGAAGAAAAAAATTCTAACGT
TGATGTATCAAAACTTCCGATAGATAATGACGAGGAAGAAAAATTTGAAT
TGCCAGCTTCAGAGTTTTCTGAAATTACAGGGACTGATATAGACTCGCCG
AAGGTATCATTTCATAAAATTCTGTCGACAATGGAATTGAGGACGAGGAT
TTCATCAGCATCTGAATCGCACGATAAGCAACCAGAAGAAGAGAATTTAA
AACCACTGGATTCATCTCCATTAAAATTAGAAAGCTTAACCACCCCATCT
CCTGGTGAAGCGAAAACTAGAGACTCCCCTTCAGTTGAATTAAAGCCGGT
TACTGAATTAGTTTCTGAGAATGTAATACCCACCACTTCCTTGGGTACTA
GTAGTATAATAACCAACGATACAAACACAACAACAAACGATTTAGACCAA
GAAAAGGAAACGTCTAGGGAAATGCGCTCGGTAGTCGAGTTCAATCTTGA
GCCTCTAAACAGACCGGAAGCCGAACTCGGACTGGATGCCGAACTCGGAC
CGGATCTCGAAGACGAACCGGGATCCGAACTTTTGCTCTGGCCAGAACGG
GAGTCCTTTATCCCACCCGTACGTTCGTCGGGGGTCAGAAATTCAACAGT
CGAACCGATTAAATCTGAGAAAGGATCGCATTCTTCTAAAAGGCCTAGAA
ATAAATCCATAACCGATCAATATGAAGTTGAGGAAAGATATATTGGCTCC
GTGAGCAAGAACCATATCCAAATTAAGGACAAAACCGCTGAGAACATAGA
TAATATTGTACCAGAATCTGAAGCAAGCTTTCTAGACCAT

BO28347.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-RA 3459 CG15143-PA 1..3456 17..3472 17280 100 Plus
CG15144-RB 3117 CG15144-PB 729..1391 556..1218 615 72.9 Plus
CG15145-RA 2631 CG15145-PA 718..926 704..912 340 77.5 Plus
CG15144-RB 3117 CG15144-PB 2071..2342 1907..2178 250 72.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-RA 3513 CG15143-RA 29..3484 17..3472 17280 100 Plus
CG15144-RB 3362 CG15144-RB 856..1518 556..1218 615 72.9 Plus
CG15145-RA 2787 CG15145-RA 718..926 704..912 340 77.5 Plus
CG15144-RB 3362 CG15144-RB 2198..2469 1907..2178 250 72.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17520921..17523947 3472..446 15135 100 Minus
2L 23513712 2L 17524007..17524246 447..208 1200 100 Minus
2L 23513712 2L 17524327..17524521 211..17 975 100 Minus
2L 23513712 2L 17527429..17528091 1218..556 615 72.9 Minus
2L 23513712 2L 17531172..17531380 912..704 340 77.5 Minus
2L 23513712 2L 17529852..17530249 2235..1838 310 71.9 Minus
2L 23513712 2L 17526478..17526749 2178..1907 250 72.8 Minus
Blast to na_te.dros performed on 2014-11-26 21:41:22 has no hits.

BO28347.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:50 Download gff for BO28347.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 29..3484 17..3474 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:33:47 Download gff for BO28347.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 29..3484 17..3474 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:40 Download gff for BO28347.complete
Subject Subject Range Query Range Percent Splice Strand
CG15143-RA 29..3484 17..3474 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:40 Download gff for BO28347.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17524329..17524521 17..209 100   Minus
2L 17524007..17524244 210..447 100 <- Minus
2L 17520919..17523945 448..3474 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:33:47 Download gff for BO28347.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17524329..17524521 17..209 100   Minus
arm_2L 17524007..17524244 210..447 100 <- Minus
arm_2L 17520919..17523945 448..3474 99 <- Minus

BO28347.pep Sequence

Translation from 16 to 3490

> BO28347.pep
MSKHNTRLDRHVKFRILQEDRLQSPRQKEDNIKRKKSTSKSENLTERGLS
SCLINSSVDLRITGGENDPAQRNVGKLPRTDSECQFKAPGYRFLTEQDTT
VNTHEVKMSPRVVTKKDLRHKCDFFAKNKDARPFKNKITQTLYRESSAQT
MAYLPEIFEANSVETLELFSLPSIFPVANRPGLHEVEILERARKRWAFSD
ALKIHFKNLLQDARKVAIKTELKEILEAIEWEQWIQREEDIQECQMMRLQ
IVIKMFDKREKEMHTASKTRIETACERIEKRRQAGLRKNEIEFQRGMRRM
EFQLTKNPRRWEKQSPMYALGSPSSEFYAPLLRYGVDPARRNFVSKTAQK
AFDMRIDDLEKRINNTDFKCPFRKLKDWSKPKKYDKEYERNFCKEDNLQK
LFESLKGLRTQANAEREEPKCLVRRRKPELGRAASQITLAYLTDLYERSD
SDEEYRKSRAYGSFSPHAKPGTNKVSETTLSHLKNDRKREEMEHMLNIYE
GTYVGWVMQFLSEEMTRLSELRRLHFFSIMAQKERWRREAAEAGLRQKEN
ELRLLYEELFQHCNVVNNEISNKYFANILSSDMYGMADGLAGETVSELAK
KIDADILRWLESFKLIQNPLTYVPLRIMLNDMISPNMNNILQRYENSLIA
QYVLEDVIFPKVWNELDPFDIGCTLTSDLIDRLIDNDLYLMSTDSESETP
QKTSWREAHAIIRKIIRQAVPGDRWLQENERIVNENYNDLFDDVFAGIFD
KSENPPAVRPSQLIELCPTVSHNYIHHMDNIREMENFHTENATSQPGSEF
EKKQLLNILRKRKEDNITRNLQNFDNPLAGEIPSDSDIFLRSQIFNPMPL
PTTTPSDLFSLRSTLDVSHASKLGSFVGRGYRVMLPSEEEKNSNVDVSKL
PIDNDEEEKFELPASEFSEITGTDIDSPKVSFHKILSTMELRTRISSASE
SHDKQPEEENLKPLDSSPLKLESLTTPSPGEAKTRDSPSVELKPVTELVS
ENVIPTTSLGTSSIITNDTNTTTNDLDQEKETSREMRSVVEFNLEPLNRP
EAELGLDAELGPDLEDEPGSELLLWPERESFIPPVRSSGVRNSTVEPIKS
EKGSHSSKRPRNKSITDQYEVEERYIGSVSKNHIQIKDKTAENIDNIVPE
SEASFLDH

BO28347.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG15143-PA 1152 CG15143-PA 1..1152 1..1152 5959 100 Plus
CG15144-PB 1038 CG15144-PB 123..1003 59..926 2259 52 Plus
CG15145-PA 876 CG15145-PA 16..829 7..817 2038 50.2 Plus