Clone BO28348 Report

Search the DGRC for BO28348

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:48
Vector:pDNR-Dual
Associated Gene/Transcriptns1-RA
Protein status:BO28348.pep: Imported from assembly
Sequenced Size:1777

Clone Sequence Records

BO28348.complete Sequence

1777 bp assembled on 2011-07-18

GenBank Submission: KX796741

> BO28348.complete
GAAGTTATCAGTCGACATGGCTTTAAAAAGGTTGAAGACCAAGAAATCCA
AGAGGCTCACCGGTCGCTTGAAGCACAAGATCGAAAAGAAGGTGCGGGAC
CACAACAAAAAGGAACGTCGCGCAGCCAAGAAGAATCCGAAGAAGGGTAG
CAAGAAACAGAAGCTCATCCAGATCCCGAACATCTGTCCCTTCAAGGATG
ACATCCTCAAGGAGGTGGAGGAGGCCAAGCAACGTCAGGAGGCCGAACGT
TTGGCTCGCCGCGAAGCCTTTAAGGCGGAACGCGAACAGAACAAGTTCAA
GACGCTGGAGTCCATGGTCGAGGATGCAGACATGCGGAGCACCGTGCACG
GAATAATGCACGAAAACGATGCCCAGGATCAGGACGAAAAGAAGTACAAG
AACGCCGTGACCAAAGAGCAGTCATTGAAGCAGTACTTCAAGGAATTCCG
CAAGGTGATAGAAAATGCCGACGTTGTCCTGGAGGTGGTTGATGCACGTG
ACCCCCTGGGAACCCGCTGCAATGAAGTTGAGCGCGCCGTTCGCGGTGCT
CCGGGCAACAAGCGACTGGTCCTGGTGCTCAACAAAGCCGACCTGGTGCC
GCGAGAGAATCTGAACAACTGGATCAAGTACTTCCGTCGCAGCGGACCTG
TCACCGCCTTCAAGGCTTCCACACAGGATCAGGCCAACCGGCTGGGACGC
CGCAAACTCCGCGAAATGAAAACCGAGAAGGCTATGCAGGGTTCTGTCTG
TATTGGCGCTGAGTTGCTTATGTCCATGCTGGGCAACTACTGCCGCAACA
AGGGCATCAAAACCTCGATTCGCGTTGGCGTCGTTGGAATTCCCAATGTA
GGCAAGAGCTCCATCATAAACTCGTTGACCCGCGGCCGGTCCTGCATGGT
GGGCAGCACGCCAGGAGTGACCAAGTCAATGCAAGAAGTAGAACTGGATT
CAAAAATCAAACTGATCGATTGTCCTGGAATCGTATTTACCAGCGGAGGT
GAAAATTCGCATGCAGTTCTGAAGAATGCTCAGCGTGTGGGCGATGTAAA
GGATCCTTTCACCATTGCCGAGAGCGTATTGAAGCGTGCCAGCAAGGAAT
ACTTCTGCACGATGTACGATATTACAAACTACGACACATTTGAAGAATTC
TTCGCCAAAAAGGCAGCCAGAATGGGCAAATTTCTAAAGAAGGGAGTTCC
AGATGTTGTGGCTGCCGCAAGAAGCGTGCTCAACGATTGGAACACGGGCA
AAATCAAATACTGCACACAGCCTCCGGAAGTTCAAGAAGGACAAAGTGTG
CATATAAGTGCCTCGATAGTACACTCAGAGGCTCGCGAATTTGATGTGGA
GAACTTTGAGTCCATGGAGACGGAAATCTTAGAGCATTGCGCCGTGAAAA
CGGATGACATTATGGAGATAACGTCTACGGGGCCTTTAGAGATTCGACAG
CCGCGTGAGGAAGCCGAACCTGCAGATAAAATAACTGCCAGTTTGGTAAT
AGACGAGAAGGAAAAGCCCGCAAAGGGTCGCAAACGAAAACTGGATGAGG
AAAAGGAGAAGGTTGATCCCAGTCTACTCCTAGAAGAAAACCAATCCCTG
AATAAAGGCATAAAGCAGATGCAAAAGCTAAAAAAGAAACAGAATGTTCG
CAACGAGAAGAAAATATCCAAAATTACAGACGTTCTGGATAGCTTTAGCT
TAGGTCCATCCTCGTCCAAGGCAGAAAAATACGATTTTGATGAGGACTAT
GTGATTGAAGCAAGCTTTCTAGACCAT

BO28348.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ns1-RA 1746 CG3983-PA 1..1743 17..1759 8430 98.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
Ns1-RA 1895 CG3983-RA 73..1815 17..1759 8430 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17071630..17072517 926..39 4350 99.3 Minus
3R 32079331 3R 17070845..17071256 1586..1175 1970 98.5 Minus
3R 32079331 3R 17071318..17071568 1176..926 1180 98 Minus
3R 32079331 3R 17070603..17070777 1759..1585 860 99.4 Minus
Blast to na_te.dros performed on 2014-11-26 21:41:51 has no hits.

BO28348.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:51 Download gff for BO28348.complete
Subject Subject Range Query Range Percent Splice Strand
ns1-RA 185..1927 17..1761 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:33:59 Download gff for BO28348.complete
Subject Subject Range Query Range Percent Splice Strand
Ns1-RA 73..1815 17..1761 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:52 Download gff for BO28348.complete
Subject Subject Range Query Range Percent Splice Strand
Ns1-RA 73..1815 17..1761 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:52 Download gff for BO28348.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17072582..17072603 17..38 100   Minus
3R 17071632..17072517 39..924 99 <- Minus
3R 17071319..17071569 925..1175 97 <- Minus
3R 17070845..17071255 1176..1586 98 <- Minus
3R 17070601..17070775 1587..1761 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:33:59 Download gff for BO28348.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12898304..12898325 17..38 100   Minus
arm_3R 12897354..12898239 39..924 99 <- Minus
arm_3R 12897041..12897291 925..1175 97 <- Minus
arm_3R 12896567..12896977 1176..1586 98 <- Minus
arm_3R 12896323..12896497 1587..1761 98 <- Minus

BO28348.pep Sequence

Translation from 16 to 1777

> BO28348.pep
MALKRLKTKKSKRLTGRLKHKIEKKVRDHNKKERRAAKKNPKKGSKKQKL
IQIPNICPFKDDILKEVEEAKQRQEAERLARREAFKAEREQNKFKTLESM
VEDADMRSTVHGIMHENDAQDQDEKKYKNAVTKEQSLKQYFKEFRKVIEN
ADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLN
NWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAEL
LMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPG
VTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTI
AESVLKRASKEYFCTMYDITNYDTFEEFFAKKAARMGKFLKKGVPDVVAA
ARSVLNDWNTGKIKYCTQPPEVQEGQSVHISASIVHSEAREFDVENFESM
ETEILEHCAVKTDDIMEITSTGPLEIRQPREEAEPADKITASLVIDEKEK
PAKGRKRKLDEEKEKVDPSLLLEENQSLNKGIKQMQKLKKKQNVRNEKKI
SKITDVLDSFSLGPSSSKAEKYDFDEDYVIEASFLDH

BO28348.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Ns1-PA 581 CG3983-PA 1..581 1..581 2956 100 Plus
Ns2-PA 674 CG6501-PA 156..647 88..583 488 28.9 Plus
Ns3-PB 606 CG14788-PB 163..506 139..424 291 26.7 Plus
Ns3-PA 606 CG14788-PA 163..506 139..424 291 26.7 Plus
Ns4-PA 575 CG9320-PA 140..494 121..424 177 24.2 Plus