Clone BO28360 Report

Search the DGRC for BO28360

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptGcn2-RA
Protein status:BO28360.pep: Imported from assembly
Sequenced Size:4801

Clone Sequence Records

BO28360.complete Sequence

4801 bp assembled on 2011-07-18

GenBank Submission: KX796380

> BO28360.complete
GAAGTTATCAGTCGACATGGCGGATGAAAAGGCCAAGGAATCCTTCCGCG
AGCGGCAAGCGCAGGAGTTGGAGGTTATAAAGTCCATCTTTGGCTGTGAT
GTGGAGGACCTAAGACCCCAGGCGAATCCTTCCCTGTGGAAGCCAACGGA
CATACGGATACAACTTACCCCACTTCGAGACTCCTCGAACGGACTGGAAA
CCTATGTGTGCACCAAGCTGCACGTCACCTGTCCATCAAAGTATCCAAAA
TTGCCCCCTAAGATATCTCTGGAGGAGTCCAAAGGCATGTCGGATCAGCT
GCTGGAGGCCCTACGCAACCAATTGCAGGCTCAATCCCAAGAGCTACGTG
GCGAAGTGATGATTTATGAATTGGCCCAGACCGTTCAGGCCTTTCTCCTC
GAACACAACAAACCACCAAAGGGATCATTCTACGACCAGATGCTCCAGGA
TAAACAGAAGCGCGACCAGGAGCTACAGGACATACAGCGGCAGCGGGAGT
CCCTGCAACGCCAGACGCTCATCGACGAGGTGGAGCGGCGCAAAGAGATG
TTCAAAACGGAGGCTAAGAGGCGCGGCGAACCAAGGCGCAGCATGAGTGA
GTCTAACCCACGGCATCCTAGCTCGTCGGAGAGCTCCGAGAACTCCTCGC
CCTACTATCGTGGTCACATCTACCCCTCCAAATGCCTGGATCACCGCAAC
ACGGAGACGCTCTACTTCCACAAGATGGGCAGGCAGATTCAGCGTGGATG
CTGCGTTGGTCACTCCCAACGAGGTTGCATCGCCTACACTGGCATAGATA
TGCACTGCGGCCAGTTGCTCTACATAACAGAATGGAACATCAAGTACAGC
CAACTGGAGCAGCCATGCATCGGCGGAGGCAAGTGCCACTGGAGCAGCGA
GTCAAAGTGCATGGGCAGTCATCGTGTGGACGAAGTGATGGCCTCCATTG
AAAAGCAGGTGTCCTCACTGTCCCAACTACAGCACAAAAACCTCGTCTCG
TACGAGTGCGTACTGTGCATCAAGCGAAAGGAAGGTCTACTTGTGTATTT
GGTCCAAGACTTCCTCCTTGGCACCAGCGTGTTCAGCATCTCCTCCTCGC
TTGGCTGGTGCATGGACGGCGCACGAATGGTTGCGCGCGGCGTGCTGGAC
GCCTTAGTATTTCTTCACAACAAGGGTGTATCCCATAGTCACCTGCTCGA
CACCACTGTTTTTATGGACAACACAGGCAATGTGAGGGTATCAGACTTTT
CGCTCGTTCCCAATCTTCTAGAACTTCTGAGCGGAGCTGGACAAAGCAGC
AGTTGCGGGGACTTACCCGCGTTAGGTGCCCTGGTGGAGAGTTTGATGCC
CACTAACAGTTACGAGATGCGCGACTTTGTAGACAAGTGTAACTCGGACC
GAACTCTTTCCGCATCAGAGTTATTGGAGCATCCATTCTTACGCTTTTAC
GTCGACAATGGCCAGCAGCAGGTGATGCCATTACCACAGCAGCAACATCC
TAACACCGTCCAGCGCACTGGATCCGCCATGCCGTACCAGATACCGACAC
TGGCCCTAAGCCAATCCCGCCTGCGAACGGAATTCGAGGTGCTCATGTAC
TTGGGAAAGGGTGCCTTTGGTGACGTGCTAAAGGTGCGCAACATTTTAGA
CAACCGAGAGTACGCCATCAAGCGCATACCATTGCCCGCGAGGAGTCGAC
AGCTGTACAAAAAGATGACGCGCGAGGTGGAGCTTCTTTCGCGGCTGAAT
CATGAGAATGTAGTTCGATACTTTAACAGTTGGATAGAAAGTGTAGATGA
CGCAGATGCCGCTGAGATGGATAAGCTGCTGGGCGGTGAGTGGTCCCAGA
GTCAGCAGGACCTTAGCGTAAAACCTGCCAAGTCACCACAGCTGGGGCCC
ACTTTAGAGGAGGACGAGGATGAAGAGGACAGCTCATCCAGCATGTGGAA
CGGTTACATACCCAACATGGAGGACTCTGATTCGGATGGCATTGAATTTG
TGGACTCCAACGGCAAGGTGGCTGTCTACGACGACGAAGAGCAGGAGGAT
TCCACCAGAGGCAAGACCAATTCGCCAAAACCTTTGATGCAGGTCATGTA
CATCCAGATGGAGTTCTGTGAGAAATGCACATTGCGCACCGCCATCGATG
ACAATCTCTTCAATGACACGGATCGTCTGTGGCGCTTATTTCGGGAGATT
GCCGAGGGTCTCGCGCATATTCACCAGCAAGGCATTATCCATCGGGACCT
AAAGCCCGTTAACATCTTCTTGGACTCGCACGATCAGATTAAGATCGGTG
ACTTTGGTCTGGCCACCACCAGTTTTCTGGCTCTCCAAGCCCACGACGCA
GCGCCTGCGCCTGTTAACCAGATAACCAGTGCGGAAGACGGCACTGGTAC
TGGTAAGGTCGGCACCACTCTATACGTGGCTCCCGAATTGACAGGAAATG
CTTCCAAGTCTGTGTACAACCAGAAGGTTGATATGTACACCCTGGGAATC
ATTCTTTTCGAGATGTGCCAACCGCCGTTCGACACAAGCATGGAGCGGGC
TCAGACCATTATGGCTCTCAGGAATGTTTCCATTAATATACCGGATGCTA
TGCTTAAGGATCCCAAGTATGAGAAGACGGTGAAGATGCTTCAGTGGCTT
CTCAACCACGATCCCGCCCAGAGACCTACTGCCGAGGAGCTGCTCATCTC
AGACCTGGTTCCACCAGCCCAGTTGGAGGCCAATGAGCTCCAAGAAATGC
TGCGTCACGCCCTCGCTAATCCGCAGAGCAAGGCCTACAAGAACCTAGTT
GCCCGATGTCTTCAGCAGGAGAGCGACGAGGTGCTGGAACACACCTACCA
CTTGGGAAGCAGTCGAGCTATGAAATCCTGGAACTCGGCAATTATAATCG
ATGATATAGTATCCCTGAACCCAGTGATTGAGTTTGTTAAGGCTAAGGTC
GTGAATTTATTCCGCAAGCATGGAGCTATAGAGGTGGACTCACCGCTCTT
ATCCCCACTTTCCGCAAGGAACAGCACTGCGAATGCGAACGCCAATGCCG
TACACCTTATGACCCACTCGGGATGTGTGGTGGTGCTACCCTGTGACCTG
CGGACTCAGTTTGCGCGTCACGTTACCATGAACAGCGTGAATCTCATCCG
GCGCTACTGTGTGGACCGTGTCTATCGGGAGGAGCGAGTGTTTAATTTTC
ATCCCAAGCAAAGCTACGACTGCTCTTTCGATATAATTGCACCCACAACT
GGAAGTCATTTAGTTGATGCCGAGCTGCTGTCGTTGGCTTTTGAAATCAC
CAGTGAACTGCCCCGATTACGCGAAAAGAATTTGGCGATCCGCATGAACC
ACACTAATCTCTTGAGGGCCATCCTCATCTTCTGCAATGTACCAAAGGCT
CAGTATGGAGCACTCTTCGAGGGCACCATGGACTTCATCGAGTCGCGCAT
CTCACGCTTCCAATTTCACTCGAGTATTACCGGGATTATGGAAAAGTCGC
GAACATCTGCTCAAACTCTGATGGACATGTTGTTAGCTAACTTTCTGCTG
ACTGGTTCCAGAAGCACTGTGGACGATTCCGCGCTGAAATCTTTGATGCG
TGGAAAGGGAGAAGCAGCTTCACTGGCAAGGGGAGCATTGCGGGAACTTG
AAACAGTTGTGGGACTGGCTTACAGTCTAGGCGTAAAGTGTCCTATACAC
ATATGGGCTGGCTTGCCCATCAGCTTCGATCGTGCCAGCAACGGTGGAAT
TGTGTGGCAGATGACCGCTGACCTGAAGCCCAATCGCTCTGGCCATCCTT
CGGTTCTGGCGATTGGGGAGAGATACGACTCTATGCTGCATGAATTCCAG
AAGCAGGCGCAGAAGTTTAATCCCGCCATGCCAGCACGTGGAGTTCTTAG
TGGAGCGGGCTTGACGTTCTCCCTAGACAAGCTGGTAGCTGCTGTGGGTG
TGGAATACGCTAAGGATTGTCGGGCGATAGATGTGGGCATTTGCGTGTGT
GGAACCCGTCCACCGCTAAAGGATGTGACCTATATCATGCGTCTGCTGTG
GTCGGTTGGCATCCGATGTGGAATTGTGGAGGCCGCCAGCGAATTGGGAG
ATGAAGCACAGGATCTTGCCCGCCTTGGGGCGTTACATGTCATCCTGGTG
GCGGAAAATGGCTCATTGAGAGTGAGATCTTTCGAGAGGGAACGATTCCA
GGAGCGTCACCTAACAAGAACCGAACTGGTGGAGTTCATCCAGAAGATGC
TGCGAAGTGATGGACTCAATGGGACCACCGTGGACAACTTCAGCCAGTTG
TCAGCCTTGGGTAGTGGTGACAACAGAAGCAGTGGTGGAAAGGAAAGAGA
ACGCGGCGAGAATGGTCTGAGCACCTCCGCATCGAATGCCACCATCAAGA
ACAACTATAGCCAGTTGCCGAATCTTCAGGTGACGTTTCTCACCCACGAC
AAGCCAACGGCGAACTACAAAAGGCGGCTAGAGAATCAGGTGGCGCAGCA
GATGAGCTCAACGCTATCGCAGTTCCTCAAGAAGGAGACCTTTGTGGTCC
TGGTGGTGGAGTTGCCGCCTGCTGTTGTAAATGCCATTGTGGGGGCCATT
AATCCACGGGAAATACGCAAGCGAGAGACTGAACCGGAAATCAACTATGT
GATCGAGCGATTTTCGAAATACAAGCGCTACATCTCCGAGATAAACGAAG
AGGTTGTCGACTATCTGAGCGATGCCAAGACTCCCATTGTGGCCTTGTAC
AGCATATCCGATTCCTACTACCGCGTCATCATCGCAAGCTTTCTAGACCA
T

BO28360.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-RB 4770 CG1609-PB 1..4767 17..4783 23775 99.9 Plus
Gcn2-RA 4770 CG1609-PA 1..4767 17..4783 23775 99.9 Plus
Gcn2-RC 4776 CG1609-PC 1..4773 17..4783 23680 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-RB 5284 CG1609-RB 332..5098 17..4783 23775 99.9 Plus
Gcn2-RA 5737 CG1609-RA 332..5098 17..4783 23775 99.9 Plus
Gcn2-RC 5290 CG1609-RC 332..5104 17..4783 23680 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31399100..31400155 2633..3688 5280 100 Plus
3R 32079331 3R 31400216..31401188 3687..4659 4835 99.8 Plus
3R 32079331 3R 31396985..31397615 758..1388 3155 100 Plus
3R 32079331 3R 31397667..31398239 1387..1959 2850 99.8 Plus
3R 32079331 3R 31396402..31396909 253..760 2525 99.8 Plus
3R 32079331 3R 31398545..31399044 2136..2635 2500 100 Plus
3R 32079331 3R 31398305..31398481 1960..2136 885 100 Plus
3R 32079331 3R 31396121..31396293 81..253 865 100 Plus
3R 32079331 3R 31401250..31401374 4659..4783 625 100 Plus
3R 32079331 3R 31395991..31396056 17..82 330 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:42:36 has no hits.

BO28360.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:52 Download gff for BO28360.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 334..5100 17..4785 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:34:23 Download gff for BO28360.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 332..5098 17..4785 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:13 Download gff for BO28360.complete
Subject Subject Range Query Range Percent Splice Strand
Gcn2-RA 332..5098 17..4785 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:40:13 Download gff for BO28360.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31401251..31401374 4660..4785 98   Plus
3R 31400218..31401188 3689..4659 99 -> Plus
3R 31399103..31400155 2636..3688 100 -> Plus
3R 31398546..31399044 2137..2635 100 -> Plus
3R 31398305..31398481 1960..2136 100 -> Plus
3R 31397667..31398239 1387..1959 99 -> Plus
3R 31396986..31397613 759..1386 100 -> Plus
3R 31396402..31396907 253..758 99 -> Plus
3R 31396123..31396292 83..252 100 -> Plus
3R 31395991..31396056 17..82 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:34:23 Download gff for BO28360.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27226973..27227096 4660..4785 98   Plus
arm_3R 27225940..27226910 3689..4659 99 -> Plus
arm_3R 27224825..27225877 2636..3688 100 -> Plus
arm_3R 27224268..27224766 2137..2635 100 -> Plus
arm_3R 27224027..27224203 1960..2136 100 -> Plus
arm_3R 27223389..27223961 1387..1959 99 -> Plus
arm_3R 27222708..27223335 759..1386 100 -> Plus
arm_3R 27222124..27222629 253..758 99 -> Plus
arm_3R 27221845..27222014 83..252 100 -> Plus
arm_3R 27221713..27221778 17..82 100 -> Plus

BO28360.pep Sequence

Translation from 16 to 4801

> BO28360.pep
MADEKAKESFRERQAQELEVIKSIFGCDVEDLRPQANPSLWKPTDIRIQL
TPLRDSSNGLETYVCTKLHVTCPSKYPKLPPKISLEESKGMSDQLLEALR
NQLQAQSQELRGEVMIYELAQTVQAFLLEHNKPPKGSFYDQMLQDKQKRD
QELQDIQRQRESLQRQTLIDEVERRKEMFKTEAKRRGEPRRSMSESNPRH
PSSSESSENSSPYYRGHIYPSKCLDHRNTETLYFHKMGRQIQRGCCVGHS
QRGCIAYTGIDMHCGQLLYITEWNIKYSQLEQPCIGGGKCHWSSESKCMG
SHRVDEVMASIEKQVSSLSQLQHKNLVSYECVLCIKRKEGLLVYLVQDFL
LGTSVFSISSSLGWCMDGARMVARGVLDALVFLHNKGVSHSHLLDTTVFM
DNTGNVRVSDFSLVPNLLELLSGAGQSSSCGDLPALGALVESLMPTNSYE
MRDFVDKCNSDRTLSASELLEHPFLRFYVDNGQQQVMPLPQQQHPNTVQR
TGSAMPYQIPTLALSQSRLRTEFEVLMYLGKGAFGDVLKVRNILDNREYA
IKRIPLPARSRQLYKKMTREVELLSRLNHENVVRYFNSWIESVDDADAAE
MDKLLGGEWSQSQQDLSVKPAKSPQLGPTLEEDEDEEDSSSSMWNGYIPN
MEDSDSDGIEFVDSNGKVAVYDDEEQEDSTRGKTNSPKPLMQVMYIQMEF
CEKCTLRTAIDDNLFNDTDRLWRLFREIAEGLAHIHQQGIIHRDLKPVNI
FLDSHDQIKIGDFGLATTSFLALQAHDAAPAPVNQITSAEDGTGTGKVGT
TLYVAPELTGNASKSVYNQKVDMYTLGIILFEMCQPPFDTSMERAQTIMA
LRNVSINIPDAMLKDPKYEKTVKMLQWLLNHDPAQRPTAEELLISDLVPP
AQLEANELQEMLRHALANPQSKAYKNLVARCLQQESDEVLEHTYHLGSSR
AMKSWNSAIIIDDIVSLNPVIEFVKAKVVNLFRKHGAIEVDSPLLSPLSA
RNSTANANANAVHLMTHSGCVVVLPCDLRTQFARHVTMNSVNLIRRYCVD
RVYREERVFNFHPKQSYDCSFDIIAPTTGSHLVDAELLSLAFEITSELPR
LREKNLAIRMNHTNLLRAILIFCNVPKAQYGALFEGTMDFIESRISRFQF
HSSITGIMEKSRTSAQTLMDMLLANFLLTGSRSTVDDSALKSLMRGKGEA
ASLARGALRELETVVGLAYSLGVKCPIHIWAGLPISFDRASNGGIVWQMT
ADLKPNRSGHPSVLAIGERYDSMLHEFQKQAQKFNPAMPARGVLSGAGLT
FSLDKLVAAVGVEYAKDCRAIDVGICVCGTRPPLKDVTYIMRLLWSVGIR
CGIVEAASELGDEAQDLARLGALHVILVAENGSLRVRSFERERFQERHLT
RTELVEFIQKMLRSDGLNGTTVDNFSQLSALGSGDNRSSGGKERERGENG
LSTSASNATIKNNYSQLPNLQVTFLTHDKPTANYKRRLENQVAQQMSSTL
SQFLKKETFVVLVVELPPAVVNAIVGAINPREIRKRETEPEINYVIERFS
KYKRYISEINEEVVDYLSDAKTPIVALYSISDSYYRVIIASFLDH

BO28360.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Gcn2-PB 1589 CG1609-PB 1..1589 1..1589 8192 100 Plus
Gcn2-PA 1589 CG1609-PA 1..1589 1..1589 8192 100 Plus
Gcn2-PC 1591 CG1609-PC 1..1591 1..1589 8179 99.9 Plus
PEK-PC 1099 CG2087-PC 860..1083 688..913 290 35.8 Plus
PEK-PB 1110 CG2087-PB 871..1094 688..913 290 35.8 Plus
PEK-PC 1099 CG2087-PC 573..693 517..637 192 39.5 Plus