Clone BO28370 Report

Search the DGRC for BO28370

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG18130-RA
Protein status:BO28370.pep: Imported from assembly
Sequenced Size:2152

Clone Sequence Records

BO28370.complete Sequence

2152 bp assembled on 2011-07-18

GenBank Submission: KX795812

> BO28370.complete
GAAGTTATCAGTCGACATGGCAAAGAAGGGGGGACAACAACAACTGCAGG
CTGACATCCAAACGGACGAGGAGCTGGAGCGTTTCATGGAGCGACCAGGA
CTCTTGGTTTTGGATGTTTACTCGGAATGGTGTGGTCCTTGCCAGGGTAT
GGTCGGATCCTTGCGTAAAATCAAACTGGATGTTGGTGGCGATAATCTGC
ATCTGGCCATTTGCAAATCGGATACGATCACGGCCTTGAAACGATTCAAT
AAGAGAAGTGAGCCCATCTGGCTTTTTGTGACGGGCGGCAGGGCCGTAAA
TCTTCTGTTCGGTTCGGATGTGCCTAAGCTGGTGAGTCTGCTGGTCAAAG
AGCTAGAGAAGACCATGCAAAAATCATCGCGTCCAGGCACCTACAGACTT
GACGAACTGCAGCCCATCGAGGTGGAGCAGCAGCGCATCAAAATGGAGGC
CATCGAGCGGGCCGAGCGGGCGGAGCGCGAGATAAAGCACAAGAAGCAGA
TAGACTACCTTAACCATGTAACGGACTCCATTATGGAGAATATGCCCGAT
ATTGGAGTGACTGTCTTTGGACCGCAAGTCAATCGTGATATGTTCAAGAA
GCTAACCGAACCAGCCGAAGCGCTCAAAATGCAGTGCAAGGATCGCCGGG
TCATCCAGGTGAGCACCGATCAGTTCGAGATTGTGAACTTTGCATGCAAG
AATCCCATGCCGCCGGATGTGATCGAACAACTGGACGGCAAGGAGCTGCT
CATGTGCTTCTGGAAGATTGACGAAAGCATCGGCACAGTGCCCAACGTTC
TAATGGCCTATGCCCACGAGCTAACCAAGGAGCGAGTGGCACCACCCAAC
GATGATATACCCGAGGAGCATGTTATACCGCCGCTAATCACAACTATGAA
ACTAAAAGTCGAGGTGGAGCTGAAGGAGGGCGAGACTTGGGTGGAGGAGA
TAAGCTCCGAAGAGGAGGCGAGGCTGCATCAGGCCAAAAGCAAGGCCAAA
ACCAAATCCATTAGCCACGAGGAAGCGCATCTGGCCGAAGAGGAAGCAGC
CGATCTGGATGCCGAGGAGGAGGCCAGCGAGGAGGAGACAGTTATGCCAG
AACCCGGCGGCGATGCAATGGGCGGGCTCCCATCAATGCCCGGCTTCGAA
CTGGAAATAGAACCCGTCGATGAGGCCGGCGAGGATGAGGAGGAGGTGCA
GGAGATCAAGGAGGAGGAGCCATCGAAGCCACTCACTCGCACCAAGACGG
TGAAAATGCCACCCATTTGGGTGCCCAACAGCCGGCGCACCCATGCCGCC
CTCATCTATGTGTTCTTCCGCGGTCAGACGTCTGGATTTCTGCCACCGGA
TCCCAAGCCGGAACCGCCGCATGTCATCATGGCGTTCGATGCCTCCAAGC
GCAAGGAGATCATGCATGTAATCGATCGACACAAGGACGATGTGCCGCTC
TATGGATTCTTCTCAAGCGCCGAACCGGATGAGGCCGAATTGATTGCCAC
CTCAACGGACAAGTACGAGAGCAGTCCGCACTCATCTGGCGACAAGATCG
TGCTGAAGGTCAACAAGGTCCAGTCCAACATGATGTTATCCCTGGTCTCG
TACGGTCCCAGCTATGTGAGTCCCAATGTAACTGTCGGCAAGGACGAGGC
GCTCAAGTTCTTCCCGGAGGACTACAAGCCCCAGGAGGAGGTCGTCGTCG
AGGTCGAAAAGAAAAAGAAGAAGAGCAAGCGGGCCACCGAAATCAATCAG
GAAATGGAGGCAGCGGCTGCAGCTGCAGCTGCAGCGGCGGCTCATCCTTC
GGAGGCTCCTGCTCCAGTCGAAGCAGAAGCTCACGCCGCAGAGGCTCCCG
CTGCCGTGGAAGGAGATGCCGCACCAGCGGCTGCCGAAGCACCGCCAGCC
GGAGATGCCGCACCGGTGGCGCCACCACCAGCTGAGCCAGCCGCCGAAGG
AGCGGCGCCAGAGGCACCGGCTCCAGCTCCAGCTCCAGCTCCAGCTCCGG
AAGCCCCAGCAGCGGAGGAGGCGCCACATGAGGCGCCCAAGGAGGAGGCA
CCTGCCGCCGAAGCGCCACCGGAACCGGAGGCAGAAGCTCCTGCTCCTGC
TCCTGCCGAGCCTGCACCTGAGCCAGCAGCCGAGGCAAGCTTTCTAGACC
AT

BO28370.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-RA 2121 CG18130-PA 1..2118 17..2134 10575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-RA 2344 CG18130-RA 103..2220 17..2134 10575 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11990977..11992230 1536..283 6255 99.9 Minus
X 23542271 X 11990242..11990654 2134..1722 2065 100 Minus
X 23542271 X 11990719..11990905 1723..1537 935 100 Minus
X 23542271 X 11992414..11992518 211..107 525 100 Minus
X 23542271 X 11992576..11992666 107..17 455 100 Minus
X 23542271 X 11992282..11992354 284..212 365 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:43:04 has no hits.

BO28370.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:53 Download gff for BO28370.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 103..2220 17..2136 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:34:39 Download gff for BO28370.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 103..2220 17..2136 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:29 Download gff for BO28370.complete
Subject Subject Range Query Range Percent Splice Strand
CG18130-RA 103..2220 17..2136 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:40:29 Download gff for BO28370.complete
Subject Subject Range Query Range Percent Splice Strand
X 11992576..11992666 17..107 100   Minus
X 11992414..11992517 108..211 100 <- Minus
X 11992283..11992354 212..283 100 <- Minus
X 11990977..11992229 284..1536 99 <- Minus
X 11990719..11990905 1537..1723 100 <- Minus
X 11990240..11990652 1724..2136 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:34:39 Download gff for BO28370.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11886609..11886699 17..107 100   Minus
arm_X 11886447..11886550 108..211 100 <- Minus
arm_X 11886316..11886387 212..283 100 <- Minus
arm_X 11885010..11886262 284..1536 99 <- Minus
arm_X 11884752..11884938 1537..1723 100 <- Minus
arm_X 11884273..11884685 1724..2136 99 <- Minus

BO28370.pep Sequence

Translation from 16 to 2152

> BO28370.pep
MAKKGGQQQLQADIQTDEELERFMERPGLLVLDVYSEWCGPCQGMVGSLR
KIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGS
DVPKLVSLLVKELEKTMQKSSRPGTYRLDELQPIEVEQQRIKMEAIERAE
RAEREIKHKKQIDYLNHVTDSIMENMPDIGVTVFGPQVNRDMFKKLTEPA
EALKMQCKDRRVIQVSTDQFEIVNFACKNPMPPDVIEQLDGKELLMCFWK
IDESIGTVPNVLMAYAHELTKERVAPPNDDIPEEHVIPPLITTMKLKVEV
ELKEGETWVEEISSEEEARLHQAKSKAKTKSISHEEAHLAEEEAADLDAE
EEASEEETVMPEPGGDAMGGLPSMPGFELEIEPVDEAGEDEEEVQEIKEE
EPSKPLTRTKTVKMPPIWVPNSRRTHAALIYVFFRGQTSGFLPPDPKPEP
PHVIMAFDASKRKEIMHVIDRHKDDVPLYGFFSSAEPDEAELIATSTDKY
ESSPHSSGDKIVLKVNKVQSNMMLSLVSYGPSYVSPNVTVGKDEALKFFP
EDYKPQEEVVVEVEKKKKKSKRATEINQEMEAAAAAAAAAAAHPSEAPAP
VEAEAHAAEAPAAVEGDAAPAAAEAPPAGDAAPVAPPPAEPAAEGAAPEA
PAPAPAPAPAPEAPAAEEAPHEAPKEEAPAAEAPPEPEAEAPAPAPAEPA
PEPAAEASFLDH

BO28370.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG18130-PA 706 CG18130-PA 1..706 1..706 3647 100 Plus
CG14221-PC 586 CG14221-PC 1..585 1..625 1457 46.8 Plus
CG14221-PB 542 CG14221-PB 1..541 45..625 1267 44.7 Plus
CG3108-PA 1132 CG3108-PA 204..626 259..698 244 27.5 Plus
Tm1-PK 518 CG4898-PK 398..518 594..704 217 55.3 Plus