Clone BO28371 Report

Search the DGRC for BO28371

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG5103-RA
Protein status:BO28371.pep: Imported from assembly
Sequenced Size:1903

Clone Sequence Records

BO28371.complete Sequence

1903 bp assembled on 2011-07-01

GenBank Submission: KX795794

> BO28371.complete
GAAGTTATCAGTCGACATGTCGAACGCTAAGCTGGACAGTAAGGTCGTTC
AGAACCTGAAGGACGTGGCCCAAAAGCTGCGGATCCACTCGATCACCTCG
ACGCAGGCGGCCAAGTCGGGACATCCGACGTCCTGTGCCTCGTTGGCCGA
GATAATGACGGTGCTGTTCTTTCAGCAGATGCGCCTAAATCTGAAGCATC
CTCGCGATCCTTCCAGCGATCGATTGGTTCTGTCCAAGGGACATGCTGCA
CCCATTCTGTACGCCGTTTGGGCGGAGGCTGGACTCTTCCCGGTGGAGGA
GCTGCGAAATTTGCGCAAGGTGGACAGTGATCTAGAGGGTCATCCCACTC
CACGGCTGAGTTTCGTCGATGTGAGCACCGGATCCCTGGGACAGGGCATC
TCCGTGGCCGCTGGAATGGCCTATGTGGGCAAACACCTGGACAAGGCCGA
CTATCGTACATATGTGATCGTGGGCGATGGCGAGGCTACCGAAGGAGCAG
TCTGGGAATCGCTCCACTTTGCCGGCCACTACTGCCTGGACAACCTGTGC
GTAATCTTCGATATGAACAAGATCTTCTGCTCGGACATAGGCACTGAAAT
GGAGGTTTATCGGGAGAGGTTGGACGCCTTCGGGTTCAATGCCCTAGTCT
TAAATGGCCACGATATTGATGAGCTGGCCAAGGCCTTCATTAATGCGGCC
AGCACGAAGGGTAAGCCCACGGCTCTTTTAGCCAGGACGACTAAGGGAAA
GGACTTTCTGGGCATCGAAGGAATCGAAGAAATGCATGCACAGCCACTGG
GTAAGAGGGCCGAATCTGCAATCAAGCATTTGCAGATGAAAATCGCAAAT
CCCAACGTCCGCCTGACACCCAAAAAGGTGGGAAAGTGCGGCCACGCCCC
CGAGGTGCATATTAACAATATAATGCTGTGCAGTCCGCCCAATTATCGGC
TGGGAGATTCGGTAGCCCCACGCTTAGCCTACGGAACCGCCTTGGCCAAA
ATCGCTGCTGATAATCCTCGGGTAATAGCCCTTGATGGCGATACAAAGAA
CTCGACATATGCGGACAAAATGAGGAATGCATTTCCAGAGCGTTTCATCG
AGTGCTTCACAGCACAGCAGAATCTGGTGGGCGTGGCCGTGGGAGCCACC
TGTCGACGTCGCACTGTGGCCTTCGTTTCGACGTATGCGACCTTTTTCAC
ACGGGCCTTTGATCAGATCCGCATGGGCGCAATTTCGCACACGAATGTGA
ACTTCGCGGGCTCCCACTGTGGCTGCAGCATCGGCGAGGATGGTCCCTCC
CAAATGGGACTGGAGGACATGGCCATGTTCAGGAGCATTCCCGGGAGCAC
GGTCTTCTATCCCACGGACGCAGTGAGCACGGAGAGGGCGGTGGAACTGG
CTGCCAATACTAAGGGCGTGTGCTACATCCGCACCACGTATCCGAGCACA
ACGGTGATCTACAACAATGACGAGGTGTTTGCCGTGGGACTGGGCAAAGT
GGTGCGCCAGAAGCCCTCGGATGAGGTGCTCCTGATTGGAGCCGGCGTCA
CATTGTACGAGTGCCTGGCCGCAGCGGAAAGATTGGAGGAGGATTGCATT
ACGGCACGAGTGATCGACCCCTTTACAGTGAAGCCCCTCGATGTCGGATT
AATCGTGAAGCATGGAAAGCTGTGTCGTGGAAGAATCGTCGTGGTGGAGG
ATCATTACCAGCAAGGCGGATTGGGCGAGGCGGTCCTCAGTGCTCTGGCC
GACTATCGAAACTTTGTGGTCAAGCATCTCTATATTACCACTGTACCGAG
ATCAGGCCCTCCTGCTGTTCTGCTGGACATGTTTGGCGTCTCCTCCAGAA
ATATATACAAAGCAAGCCTGGCCATCATGAAGAAGGCAAGCTTTCTAGAC
CAT

BO28371.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-RA 1872 CG5103-PA 1..1869 17..1885 9090 99.1 Plus
CG8036-RD 1743 CG8036-PD 944..1631 1089..1776 1070 77 Plus
CG8036-RC 1881 CG8036-PC 1082..1769 1089..1776 1070 77 Plus
CG8036-RD 1743 CG8036-PD 7..414 161..568 855 80.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-RA 2074 CG5103-RA 35..1903 17..1885 9090 99.1 Plus
CG8036-RD 2179 CG8036-RD 1233..1920 1089..1776 1070 77 Plus
CG8036-RC 2235 CG8036-RC 1289..1976 1089..1776 1070 77 Plus
CG8036-RD 2179 CG8036-RD 257..703 122..568 915 80.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18292296..18293348 1885..833 5070 98.8 Minus
3L 28110227 3L 18293410..18294228 835..17 4035 99.5 Minus
3R 32079331 3R 8672688..8673314 1089..1715 990 77.2 Plus
3R 32079331 3R 8671712..8672158 122..568 915 80.3 Plus
Blast to na_te.dros performed on 2014-11-26 16:45:35 has no hits.

BO28371.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-01 16:31:32 Download gff for BO28371.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 218..2086 17..1887 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:05 Download gff for BO28371.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 35..1903 17..1887 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:26:51 Download gff for BO28371.complete
Subject Subject Range Query Range Percent Splice Strand
CG5103-RA 35..1903 17..1887 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:26:51 Download gff for BO28371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18293410..18294228 17..835 99   Minus
3L 18292293..18293345 836..1887 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:05 Download gff for BO28371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18286510..18287328 17..835 99   Minus
arm_3L 18285393..18286445 836..1887 98 <- Minus

BO28371.pep Sequence

Translation from 16 to 1903

> BO28371.pep
MSNAKLDSKVVQNLKDVAQKLRIHSITSTQAAKSGHPTSCASLAEIMTVL
FFQQMRLNLKHPRDPSSDRLVLSKGHAAPILYAVWAEAGLFPVEELRNLR
KVDSDLEGHPTPRLSFVDVSTGSLGQGISVAAGMAYVGKHLDKADYRTYV
IVGDGEATEGAVWESLHFAGHYCLDNLCVIFDMNKIFCSDIGTEMEVYRE
RLDAFGFNALVLNGHDIDELAKAFINAASTKGKPTALLARTTKGKDFLGI
EGIEEMHAQPLGKRAESAIKHLQMKIANPNVRLTPKKVGKCGHAPEVHIN
NIMLCSPPNYRLGDSVAPRLAYGTALAKIAADNPRVIALDGDTKNSTYAD
KMRNAFPERFIECFTAQQNLVGVAVGATCRRRTVAFVSTYATFFTRAFDQ
IRMGAISHTNVNFAGSHCGCSIGEDGPSQMGLEDMAMFRSIPGSTVFYPT
DAVSTERAVELAANTKGVCYIRTTYPSTTVIYNNDEVFAVGLGKVVRQKP
SDEVLLIGAGVTLYECLAAAERLEEDCITARVIDPFTVKPLDVGLIVKHG
KLCRGRIVVVEDHYQQGGLGEAVLSALADYRNFVVKHLYITTVPRSGPPA
VLLDMFGVSSRNIYKASLAIMKKASFLDH

BO28371.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG5103-PA 623 CG5103-PA 1..623 1..623 3218 100 Plus
CG8036-PC 626 CG8036-PC 1..625 1..622 2463 73.6 Plus
CG8036-PB 626 CG8036-PB 1..625 1..622 2463 73.6 Plus
CG8036-PD 580 CG8036-PD 1..579 47..622 2292 73.6 Plus