Clone BO28372 Report

Search the DGRC for BO28372

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:72
Vector:pDNR-Dual
Associated Gene/TranscripteIF3-S9-RA
Protein status:BO28372.pep: Imported from assembly
Sequenced Size:2104

Clone Sequence Records

BO28372.complete Sequence

2104 bp assembled on 2011-07-19

GenBank Submission: KX794473

> BO28372.complete
GAAGTTATCAGTCGACATGGCCAAGAAGAAAAGCGAGGAGCACTCCGGTA
CGGATGCGAACGACAGTGATTACCAGGAGGAGCCGAACTTTGACGATCCG
CCCGGGTTCGTGGACAACATTAGTGATGAAGATCTGTTGGGCGACATGTT
GGCCCAGCGCCCCTCGGAGGCCGATGGCGTCGAGAGTGTGGTGGTAGTGG
ACAATATCCCAAAGGTGGAGCCGGTGCGCCTGGAGAAGCTGAAGTTGGTC
ATCAACAAGCTGTTTTCGAACTACGGAGAAATCGTCAATGTGGTCTATCC
CGTCGACGAGGAGGGCAAAACCAAGGGCTACGCCTTCATGGAGTACAAGC
AGGCCAGACAGGCGGAGGAAGCCGTCAAGAAGCTCAACAATCATCGCCTA
GACAAAAACCACACCTTTGCCGTCAATCTCTTCACCGATTTCCAAAAGTA
CGAAAACATCCCCGAGAAGTGGGAGCCGCCAACCGTGCAGACCTTCAAGG
TGCAGAGCGATCTATACAACTTCATCAATGACCCGGACACTTATGACCAG
TACTGCGTGGCAGCGGAGACCGCTCCCAACTGCGTGCAGGTTGGTTTCTG
GCAAAACGTATTGCCCGAACCCTTTGAGCTGGAGACCCGCGAACGCTTCA
CCGACACCTTCGTCAAGTGGTCGCCCCTGGGTACTTATGTAGTCACCTTC
CACAAACCCGGCGTGGCCATCTGGGGTGGCAGTAGCTTCCAGAAGATTCA
GAAGTTCCCCCATCCTGGTACCCAATTCGTTGAGTTTTCGCCCTGCGAGA
ATTACCTAGTTACTTACGGACCGACACCCACGGGCCAAAAGATCATCATT
TGGGACATTCGCACTGGAGCCGAGAAGCGTTCGTTTGTTGCCGATGGCAT
GTCGGTTCTTTCTATGTTCCGCTGGTCGCACGACGACAAGTTTGTGGCCC
GCATGGGCGAGAATTCGATCCACATCTACGAGACACCCTCTTTCTATCTT
CTGGACCTGAAGTCCATTAAGATTCCCGGCATTCGTGGCTTCTCTTGGTC
CCCCACAGACAACGTGATTGCCTACTGGGTGGAGGAGCAGAACCAAATAC
CCGCCCGCGTTACCCTGATGGAGATCCCCAAGAAGCGTGAGATCCGTAAC
AAGAACCTTTTCCATGTGGCCGATTGCAAGTTACATTGGCAAAAGTCCGG
CGACTATCTGTGCGTTAAGGTAGATCGTTACTCAAAGTTGAAGAAGGATA
AGAAGGACCTGGACGTCAAGTTTCTGGGCATGTTCTACAACTTTGAGATC
TTCCACATGCGCGAGAAGGAGATTCCCGTCGACTCTGTGGAGATTCGTGA
GCTTATTTTGGCCTTTGCCTGGGAGCCCGTCGGCAACAAGTTCTCCATCA
TTCACGGCGAGACCAACTCGTCGAATGTGAGCTTCTACGAGGTGAACAAG
GGCGTTAAGCCCAGCTTGGTGAAGCGTCTAGAAAAGAAGTCATGCACACA
TCTGTTCTGGTCGCCACGCGGTCAGTTTATCGTAATGGCCAACCTCACCA
TGGGTACCTTCGAGTTTGTGGACTCCACCAACGATTACATCATCACGGCA
TCGCCCGATCATTTCCGCGCTTCCGAGGTCGAGTGGGATCCCACTGGACG
CTACGTTGTGACTGGTGTCTCGTCATGGAAGGTGAAGGAGGATACCGGCT
TCAACATGTACACGTTCCAGGGCCGCATCATCAAGCGTACCATTCTCAAG
AACTTTGTGCAGTTCTTGTGGCGCCCGCGTCCTCCCACCCTGCTTAGCGA
GGAGAAGCAGAAGGAGATCAAGAAGAACTTGAAGAAGTACTACGCTGCCT
TCGAACAAAAGGATCGCCTGCGCCTTACCCGTGCCTCCAAGGAGCTGCTC
GAGAAGCGCTCTCAGCTGCGCGAGACCTTTATGGAGTACCGCAACAAGCG
TATTGCCGAGTGGGCGGAGCAGAAGAGTCGTCGCATCATGCTGCGAGGGC
ATGTGGACACAGACAACCTGGAAACTGACGAAGTGGATGAAGAAATTGTT
GAATTTTTAGTCAAGGAAGAAGTCACTCTGCTCGAGGCAAGCTTTCTAGA
CCAT

BO28372.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-RA 2073 CG4878-PA 1..2070 17..2086 10155 99.4 Plus
eIF3-S9-RB 2073 CG4878-PB 1..2070 17..2086 10155 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-RA 2565 CG4878-RA 133..2202 17..2086 10155 99.4 Plus
eIF3-S9-RB 2481 CG4878-RB 128..2197 17..2086 10155 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17537070..17538622 448..2000 7615 99.4 Plus
2R 25286936 2R 17536694..17537014 130..450 1575 99.4 Plus
2R 25286936 2R 17536465..17536579 17..131 575 100 Plus
2R 25286936 2R 17538694..17538779 2001..2086 415 98.8 Plus
Blast to na_te.dros performed on 2014-11-26 22:02:43 has no hits.

BO28372.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-19 13:05:42 Download gff for BO28372.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RA 253..2322 17..2088 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:44:52 Download gff for BO28372.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RB 128..2197 17..2088 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:49:37 Download gff for BO28372.complete
Subject Subject Range Query Range Percent Splice Strand
eIF3-S9-RB 128..2197 17..2088 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:49:37 Download gff for BO28372.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17538694..17538779 2001..2088 96   Plus
2R 17537070..17538622 448..2000 99 -> Plus
2R 17536696..17537011 132..447 99 -> Plus
2R 17536465..17536579 17..131 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:44:52 Download gff for BO28372.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13426199..13426284 2001..2088 96   Plus
arm_2R 13424575..13426127 448..2000 99 -> Plus
arm_2R 13424201..13424516 132..447 99 -> Plus
arm_2R 13423970..13424084 17..131 100 -> Plus

BO28372.pep Sequence

Translation from 16 to 2104

> BO28372.pep
MAKKKSEEHSGTDANDSDYQEEPNFDDPPGFVDNISDEDLLGDMLAQRPS
EADGVESVVVVDNIPKVEPVRLEKLKLVINKLFSNYGEIVNVVYPVDEEG
KTKGYAFMEYKQARQAEEAVKKLNNHRLDKNHTFAVNLFTDFQKYENIPE
KWEPPTVQTFKVQSDLYNFINDPDTYDQYCVAAETAPNCVQVGFWQNVLP
EPFELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSSFQKIQKFPHP
GTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNV
IAYWVEEQNQIPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCV
KVDRYSKLKKDKKDLDVKFLGMFYNFEIFHMREKEIPVDSVEIRELILAF
AWEPVGNKFSIIHGETNSSNVSFYEVNKGVKPSLVKRLEKKSCTHLFWSP
RGQFIVMANLTMGTFEFVDSTNDYIITASPDHFRASEVEWDPTGRYVVTG
VSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYAAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWA
EQKSRRIMLRGHVDTDNLETDEVDEEIVEFLVKEEVTLLEASFLDH

BO28372.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3-S9-PA 690 CG4878-PA 1..690 1..690 3667 100 Plus
eIF3-S9-PB 690 CG4878-PB 1..690 1..690 3667 100 Plus