Clone BO28381 Report

Search the DGRC for BO28381

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG32495-RB
Protein status:BO28381.pep: Imported from assembly
Sequenced Size:1507

Clone Sequence Records

BO28381.complete Sequence

1507 bp assembled on 2011-07-19

GenBank Submission: KX797271

> BO28381.complete
GAAGTTATCAGTCGACATGTCCAGCGACGCCAATACGGCCGTGCTGCGCA
ACTGCATCCGCTTGCCGCTGGCGGAGGATGAGCTACTGGAGGTGACGGCC
AAGGCCAAGGATTATGCCATTATGCACGGCGCCGCCATGCGATCGAAGAC
GGCCTTCAGTCCGGACTCGTTGAATTTCGCCCCCTTCGTGCTGGTGCCTT
CCTCGTTTCCGCGCAAGGAGTTCGAAAAGGCGGTGGCCCTACAGCCGATC
ATCAACCGGCTGATGCACAATGTGGCCCACGACGAGGAGTTCATCACGAC
GACGCTGGCGGAGACGATCAAAGTGGACGAGTTCACGGCCAATCTGTTCA
ACATCTATCGCAAGGTGCTGGCGCACGGATTCACCCAGGCATATAGCATC
GGTCTGTTGCGATCCGACTATATGGCACACGTGTCCGAGGGCTGTGCGAT
AAAGCAGGTCGAGATCAACACGGTGGCCTCCAGTTTCGCTGGCATAGCCA
CCCAATTGGTGCCGCAGCAGAAATTCGTACTCAGCGAGCTGGGACATGCG
GATAAGCTGCACAATATGCCGGATAACAATGCACTGGCCGGACTCTGCGA
TGGCATGGTGAAGGCGTGGGACATCTATGCAAAGCCGCAGGCCGTCATTC
TGTTCATCATCGAGGATGTGTCGTACAACATTTGCGACCAGCGGTTCCAC
GAGTTCTACATTCGCGAGACATATCCGCACATCAAGGTGCTGCGCCGCAC
CCTCACCGAGGTCCATCGGGAGGGCAAACTGGGCCAGTCCAAGGAGTTGC
TCCTTGGATCCCAAGAGGTGGCCGTCATCTACTTCCGAGCTGGCTACGAG
CCCGGACACTATCACTCGCAGGCGGATTGGGATGCCCGCTATCTGATGGA
GACCTCGCTGGCCATCAAGTGCCCGTCGATTCACTACCATTTGGCGGGCA
CCAAGAAGGTGCAGCAGGCATTGGCGCAGCCGGCGGTGCTCGAGCGTTTC
ATCAACGATCCGGAGGAGATCAAGGCGGTGGGCAAGATCTTCACGGGTCT
CTACTCGCTGGACGACAACGAGGCGGGCAATGCCAGCTACGAGATGGCGC
TGCGCACTCCGGAGAGATTCGTGCTGAAGCCGCAGCGCGAGGGAGGCGGC
AATAATGTCTACGGCGTGGATATACCAGATGCACTAAAGCGCATGTCACG
CGTGGAGCGCTCCGCCTGGATTCTGATGGATCTGATTCATCCGCCGCTGA
CCAAGGGCTATATGGTGCGGCCCGGTGGCGATATGCCGCCCCAGATCGTG
GACATGGTCTCCGAGCTGGGCATCTTCGGTGTGGTGATCGGAGATGCGGA
GCACATTGTGCACAACTACCAGGCGGGACACATGCTGCGCACAAAGCTCT
CAACCGCCAACGAAGGAGGCGTGGCAGCCGGTCTGGGCGCCCTGGACAGT
CCATATCTGATCGATAGCGATGACGAGGATGAGCAGAAGGCAAGCTTTCT
AGACCAT

BO28381.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
GS-RJ 1476 CG6835-PJ 1..1473 17..1489 7365 100 Plus
GS-RE 1476 CG6835-PE 1..1473 17..1489 7365 100 Plus
CG32495-RG 1476 CG32495-PG 1..1473 17..1489 7365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
GS-RJ 1789 CG6835-RJ 165..1638 16..1489 7370 100 Plus
GS-RE 1938 CG6835-RE 314..1787 16..1489 7370 100 Plus
CG32495-RG 1938 CG32495-RG 314..1787 16..1489 7370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17897691..17898075 805..1189 1925 100 Plus
X 23542271 X 17905113..17905497 805..1189 1925 100 Plus
X 23542271 X 17898151..17898452 1188..1489 1510 100 Plus
X 23542271 X 17905573..17905874 1188..1489 1510 100 Plus
X 23542271 X 17897376..17897614 566..804 1195 100 Plus
X 23542271 X 17904798..17905036 566..804 1195 100 Plus
X 23542271 X 17890461..17890674 176..389 1070 100 Plus
X 23542271 X 17900616..17900829 176..389 1070 100 Plus
X 23542271 X 17889990..17890149 16..175 800 100 Plus
X 23542271 X 17900145..17900304 16..175 800 100 Plus
X 23542271 X 17896525..17896661 386..522 685 100 Plus
X 23542271 X 17903945..17904081 386..522 685 100 Plus
U 3151297 U 1396054..1396190 386..522 685 100 Plus
U 3151297 U 1406393..1406529 386..522 685 100 Plus
X 23542271 X 17897188..17897230 523..565 215 100 Plus
X 23542271 X 17904610..17904652 523..565 215 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:56:39 has no hits.

BO28381.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-19 10:53:19 Download gff for BO28381.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RE 315..1787 17..1491 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:41:38 Download gff for BO28381.complete
Subject Subject Range Query Range Percent Splice Strand
GS-RJ 166..1638 17..1491 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:46:31 Download gff for BO28381.complete
Subject Subject Range Query Range Percent Splice Strand
CG32495-RG 315..1787 17..1491 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:46:31 Download gff for BO28381.complete
Subject Subject Range Query Range Percent Splice Strand
X 17905575..17905874 1190..1491 99   Plus
X 17905113..17905497 805..1189 100 -> Plus
X 17904798..17905036 566..804 100 -> Plus
X 17904610..17904652 523..565 100 -> Plus
X 17903948..17904081 389..522 100 -> Plus
X 17900616..17900828 176..388 100 -> Plus
X 17900146..17900304 17..175 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:41:38 Download gff for BO28381.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17799608..17799907 1190..1491 99   Plus
arm_X 17799146..17799530 805..1189 100 -> Plus
arm_X 17798831..17799069 566..804 100 -> Plus
arm_X 17798643..17798685 523..565 100 -> Plus
arm_X 17797981..17798114 389..522 100 -> Plus
arm_X 17794649..17794861 176..388 100 -> Plus
arm_X 17794179..17794337 17..175 100 -> Plus

BO28381.pep Sequence

Translation from 16 to 1507

> BO28381.pep
MSSDANTAVLRNCIRLPLAEDELLEVTAKAKDYAIMHGAAMRSKTAFSPD
SLNFAPFVLVPSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAET
IKVDEFTANLFNIYRKVLAHGFTQAYSIGLLRSDYMAHVSEGCAIKQVEI
NTVASSFAGIATQLVPQQKFVLSELGHADKLHNMPDNNALAGLCDGMVKA
WDIYAKPQAVILFIIEDVSYNICDQRFHEFYIRETYPHIKVLRRTLTEVH
REGKLGQSKELLLGSQEVAVIYFRAGYEPGHYHSQADWDARYLMETSLAI
KCPSIHYHLAGTKKVQQALAQPAVLERFINDPEEIKAVGKIFTGLYSLDD
NEAGNASYEMALRTPERFVLKPQREGGGNNVYGVDIPDALKRMSRVERSA
WILMDLIHPPLTKGYMVRPGGDMPPQIVDMVSELGIFGVVIGDAEHIVHN
YQAGHMLRTKLSTANEGGVAAGLGALDSPYLIDSDDEDEQKASFLDH

BO28381.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
GS-PJ 491 CG6835-PJ 1..491 1..491 2542 100 Plus
GS-PE 491 CG6835-PE 1..491 1..491 2542 100 Plus
CG32495-PG 491 CG32495-PG 1..491 1..491 2542 100 Plus
CG32495-PB 491 CG32495-PB 1..491 1..491 2542 100 Plus
GS-PI 562 CG6835-PI 214..562 143..491 1748 95.7 Plus