Clone BO28385 Report

Search the DGRC for BO28385

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:85
Vector:pDNR-Dual
Associated Gene/Transcripttoc-RC
Protein status:BO28385.pep: Imported from assembly
Sequenced Size:2698

Clone Sequence Records

BO28385.complete Sequence

2698 bp assembled on 2011-07-18

GenBank Submission: KX794794

> BO28385.complete
GAAGTTATCAGTCGACATGGGCTTACGTAGGTTTATTCGCAAGCATTTTG
GCAGTAAAAATTCATTGGGCAGTGCAGTTAAAATTATAAAAAGCATAGAG
AACGACGAGTTGAAAAATAAACGTTTAAATGGCACTTTGGCCAGCACGGC
AGCAATTGCAACACCCATCAAAGGAGTGGCCACCAAATCCGGAGCCACAA
ACAAGCTGCAACAATCGGCAAAAACTAAATCAACCGCGAGTATCAAAAGT
CCAGCAATTGTCGGCGTTTCCGAGGAATCCCTGCGCTCTGGCGTGGATCA
AACCGAACTTCAGGAGCTGAACAATGGGCAATCTGCTACCGGTTGTCCGA
CGCCGCCGATGGCGCGGGACTCAAAGCGTACGTCCATTGGAAATGAGTTA
CCCTGTGAGACGGAGGCCAAGTTGAAGAGATGCGAGGACCAGCAGGATCC
ACAAGCATCCACGACGGCATCACCCCTACCGATGATCAATCCACAGGAAC
AAGAAGCCAGTGGCCAGGTCAAAGAAGCAACAATCACCACTGCAAATGAG
CCAAACGCCTTGTCCTTGCCCGACGAAATCAGCAATTCGGTCAGCTCGAC
GACGATGCTGGCCACGCCCCGCGTAGACATAGCCGCCCAGTATCCCGTCC
TGAAACCATTCACGGAGAACGGAGAGCTGGACTGTGCACGACTGGCCAAA
TTCTTCCAGGACACCCAGTTCGAGAGGAAGGAGGAGCAACGCCAGATTCT
GGGCCTCTCCGTAATGGTGCAGTTCATGTCCAAAGAGCTGGATGCGGTTG
CCTGCAAGGAGAACAAACATCAATGCGCCCGGACCAAGGGAACGCTAGAG
AAGACTATATTGCTGCTACAGCATACGCAAAAGGATTGCGAGCGACTACG
CGAGGATTTGGAGGACAAGGGCCTGGAGTGGATTCAGCGGCAGCAGGAGA
AGGAATATCTGCATCGCACTGAACTGAAGCAAGCTGAAGAGAAATTAATG
GAGGTGCAATTGCGTGCCAAGTTAAAGTTCTGCGAATTAGAGTCCCAACT
GCGTGCCAAGGACGAGGAGAGCAAACAGGCACAGGAGGCCTACAGAATGG
AGGTCTCCCACAAACTTGCACTGAAGCAGGAACATCTGCGCACTGCCGAG
CAGAAAATCCAGGAACTGCAGACACGTCTTCAGCAGGTGGAGACCGAGGA
GCAGGGGCACCGCGAGGAGCTGATCCGCAAGGAGAACATTCACACCGCCC
GGCTGGCCGAGGCCAATCAGCGGGAGCAGGATCTGATCGACCGGGTCAAG
AGCCTGACCAAGGAGCTGAACACCCTGAAGGCCAACAAGGAGCATAACGA
ACGCGATTTGAGGGATCGGCTGGCGCTGTCCCAGGACGAAATCTCTGTGC
TGCGCACATCCTCACAGCGCCGCAGCCCCTGCACCAGTTTGCCGGACAAC
GCGTCCGCCGAACTCAACCGCTTGACCAGCGAGGCAGACAGCTTGCGCTG
TGTGCTTGAGCTCAAGCAGGCGGAGATTTCCGCCCTTAGCAAGGCCAAGG
CGGATCTGATTCATGAAAGCGAGGAGCGGCTTAAACTGAGTAACCGCGTG
GCCCTTTTGGAGGCCCAAAACGAAATGCTGCGCACCGAACTGGAGGCCAA
GACCGAAAAGGAGAAGGAAATCCAGCAAAAGATGGAGGAACTTCAGAAGG
CCTACAAATACGAGAGCATTAAACGCACGCGGCTGACGTATGACAAAGAG
GAGCTACAGTACCACCTTAAGCAGAGATCATTGCAGCTCCAGTCGGCTGA
GTCAAAGTTGCAAGATCTTTCCACTGGTTCCCACGATAACAGCCTATCTA
GCCACAGCCGATGCAGCCTGGGTCGCAGTGGCCTGGAGATCGCCGTGACC
ACCTCCTCGCCCACTTCCCCAGTGATGAAGGGAATGATTGAACGGAATGA
TTCCGTCAGCTGGACGCTAGAGATCGAAGATGAGTCGTTCAAGGGTAACA
CTTCAAAGATTGTGCGCAGGGCGGGGTCACTGCGAAGCAACAACGAGCGG
TGCCCCATCCAGCGGCGACAGACATTGACAAGCAATGGACACTCCAATGG
ATCGGCCACAAATGGCGGCTCTTCCCCCGCTCATCCTAATCCCCTTAGCC
AGAGCATGTCGGCCACAGCCCTTCTGAGAAGCAGCAGTAATTCCGGGGAG
TCAGAGGGTCGTCCTTTGTCCCGGGCTCGCTCAAAATCGATGTGCATCAA
AGCGTCCGCCACCAGTTCGGCGGTGTGCGAATCGTCTGGCCAAAGGAAGA
AACCACAAGACGAGTTGAGTCTGGCCGACTGGCCCGAGGATATTCCCCTG
TGCTCCAGTTCACCACAAGCGCCGGGAATAGAGATGCGTCCGCGCAGCTC
CACCATGAAGCTAATGTCCAGCGAGGCAAAGAAGTTCCAGGAAATCCAGG
AGTCCGCCGGCGAGGCCATGGTCTCCGGTGCTAACTCGGAGGACGAGAGC
TGTTCGGCCTCATCCGAGGACATAATGCGCAGCTCTTCCGCCTCCAGCAC
CGCATCGGGTGGATCCCTATCCAAGAGGCCAAAGCAACCACCATCCCGCA
TGTCCATCGAGGAGGCTCTGCCCTGCACCCCCATGGAGGTAAGCTGGTCA
GAAGACGCTGCCGATGCCAACGGACTGGCAGCAAGCTTTCTAGACCAT

BO28385.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
toc-RC 2667 CG9660-PC 1..2664 17..2680 13185 99.7 Plus
toc-RI 2811 CG9660-PI 245..2808 117..2680 12700 99.7 Plus
toc-RH 2982 CG9660-PH 272..2835 117..2680 12700 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
toc-RC 3121 CG9660-RC 137..2800 17..2680 13185 99.7 Plus
toc-RI 3266 CG9660-RI 382..2945 117..2680 12700 99.7 Plus
toc-RH 4787 CG9660-RH 852..3415 117..2680 12700 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3069717..3070731 2680..1666 5060 99.9 Minus
2L 23513712 2L 3070822..3071506 1666..982 3365 99.4 Minus
2L 23513712 2L 3080994..3081269 550..275 1380 100 Minus
2L 23513712 2L 3080651..3080889 787..549 1150 98.7 Minus
2L 23513712 2L 3071569..3071766 983..786 990 100 Minus
2L 23513712 2L 3094217..3094375 275..117 795 100 Minus
2L 23513712 2L 3094460..3094559 116..17 485 99 Minus
Blast to na_te.dros performed 2014-11-26 21:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 569..710 84..230 122 61 Plus
Penelope 804 Penelope 804bp Derived from AF418572 (AF418572) (Rel. 70, Last updated, Version 3). 124..265 84..230 122 61 Plus

BO28385.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 16:37:18 Download gff for BO28385.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 137..2800 17..2682 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:41:05 Download gff for BO28385.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 137..2800 17..2682 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:46:05 Download gff for BO28385.complete
Subject Subject Range Query Range Percent Splice Strand
toc-RC 137..2800 17..2682 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:46:05 Download gff for BO28385.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3094460..3094559 17..116 99   Minus
2L 3094217..3094375 117..275 100 <- Minus
2L 3080994..3081268 276..550 100 <- Minus
2L 3080651..3080887 551..787 98 <- Minus
2L 3071569..3071764 788..983 100 <- Minus
2L 3070823..3071504 984..1665 99 <- Minus
2L 3069713..3070731 1666..2682 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:41:05 Download gff for BO28385.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3094460..3094559 17..116 99   Minus
arm_2L 3094217..3094375 117..275 100 <- Minus
arm_2L 3080994..3081268 276..550 100 <- Minus
arm_2L 3080651..3080887 551..787 98 <- Minus
arm_2L 3071569..3071764 788..983 100 <- Minus
arm_2L 3070823..3071504 984..1665 99 <- Minus
arm_2L 3069713..3070731 1666..2682 99 <- Minus

BO28385.pep Sequence

Translation from 16 to 2698

> BO28385.pep
MGLRRFIRKHFGSKNSLGSAVKIIKSIENDELKNKRLNGTLASTAAIATP
IKGVATKSGATNKLQQSAKTKSTASIKSPAIVGVSEESLRSGVDQTELQE
LNNGQSATGCPTPPMARDSKRTSIGNELPCETEAKLKRCEDQQDPQASTT
ASPLPMINPQEQEASGQVKEATITTANEPNALSLPDEISNSVSSTTMLAT
PRVDIAAQYPVLKPFTENGELDCARLAKFFQDTQFERKEEQRQILGLSVM
VQFMSKELDAVACKENKHQCARTKGTLEKTILLLQHTQKDCERLREDLED
KGLEWIQRQQEKEYLHRTELKQAEEKLMEVQLRAKLKFCELESQLRAKDE
ESKQAQEAYRMEVSHKLALKQEHLRTAEQKIQELQTRLQQVETEEQGHRE
ELIRKENIHTARLAEANQREQDLIDRVKSLTKELNTLKANKEHNERDLRD
RLALSQDEISVLRTSSQRRSPCTSLPDNASAELNRLTSEADSLRCVLELK
QAEISALSKAKADLIHESEERLKLSNRVALLEAQNEMLRTELEAKTEKEK
EIQQKMEELQKAYKYESIKRTRLTYDKEELQYHLKQRSLQLQSAESKLQD
LSTGSHDNSLSSHSRCSLGRSGLEIAVTTSSPTSPVMKGMIERNDSVSWT
LEIEDESFKGNTSKIVRRAGSLRSNNERCPIQRRQTLTSNGHSNGSATNG
GSSPAHPNPLSQSMSATALLRSSSNSGESEGRPLSRARSKSMCIKASATS
SAVCESSGQRKKPQDELSLADWPEDIPLCSSSPQAPGIEMRPRSSTMKLM
SSEAKKFQEIQESAGEAMVSGANSEDESCSASSEDIMRSSSASSTASGGS
LSKRPKQPPSRMSIEEALPCTPMEVSWSEDAADANGLAASFLDH

BO28385.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
toc-PC 888 CG9660-PC 1..888 1..888 4438 100 Plus
toc-PI 936 CG9660-PI 74..936 25..888 4273 99.2 Plus
toc-PH 993 CG9660-PH 91..953 34..894 4272 99.2 Plus
toc-PE 945 CG9660-PE 91..945 34..888 4270 99.9 Plus
toc-PD 984 CG9660-PD 130..984 34..888 4270 99.9 Plus