Clone BO28389 Report

Search the DGRC for BO28389

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:89
Vector:pDNR-Dual
Associated Gene/Transcriptorb-RB
Protein status:BO28389.pep: Imported from assembly
Sequenced Size:2773

Clone Sequence Records

BO28389.complete Sequence

2773 bp assembled on 2011-07-19

GenBank Submission: KX796334

> BO28389.complete
GAAGTTATCAGTCGACATGTTGGGAGTCGAGAAGCCATATGTGGTAGAGC
CAGCTATGGCCGTAGCGCAGGACTCGTTTGAATTTGGCAGCAACGGCGAT
GGGAGCTCCACCAACAGCCACACAAGCAACGCCAGCTCCAAGGACCTTGG
CAGACTGACTAGTGGCGACGGAGCCCAGAACTTCGCCCAAGACAGCAGTG
CCAACAGCATTGACCAGGACAGCACGGACAACACAAACAGCGACTGCAAT
CCAATCACACTGAACGATCTACTCGGCTTGTGCGGTGCCAGCACTGCCAA
TGAAGTGGTCGGTACTGGCCAGACCCCCTCGACATCAGCGCCGATACTTG
GAGCAGGAGGAGGCGGAAGAGCAAATGGAGTTACAGCCGGCGCAGCAACG
GCAACAGGAGTGGGAGTTGGAGCTGGAGGGACATTACCTGGGCCAGGAGT
TCCATCGATCCAGGGAGGTGGTGGAGGAGGAGTCGTGGGACAACAAACCA
ATGCCTCGTGCAACACCTCAGCGGCTAACCCATCAGCCAGCTTCGGTGGC
AACGGCAGCAGCAGCGACGTCAATAATCTGCTGCTCGCCAGTGCTGCTGC
CGCTGCCGCCGCGGCTGCCGGTGATGGCGCTCAACTGTCCGCCAATGCGG
CAGCCTACGCTCCGCTGACGCCCAGCTCCACTCATTCATCGGCCTCGCCG
GGCACAAAGTCCAATTTTGACTACTTCCAGTTTGAAAATGTTGCACAAAG
TAACCCACTTAAGGCTTTCCAAAGAACAAACATCAGCTTCGATTGCTCTG
CACCCTTATCGCCAAGTACGCCTACATCTATTTACAATCGCTCCTTTCAC
AGTTCACCTTTAGTCAGCGACAGCAGCAACTCGTCCAGCGGCATTGGACT
CTCCATGGACTCCATCAACATGTTCTACAACCAGCAACAACAACAGCAAC
AGCCGGAGCAGCAAGGTTACACCAGTTTGGGCAACTCCATGGGCAGCGGA
TTGGGACTTAGTTTGGCAAACGCTTCCACGCGCTCGAACTCGCCAGAGAG
TCAGAACAGCAGCAATTCAACGACTGAACAAAATCTACTGGACATGATTA
ATTTGCTGTCTGTAAATAGCAACAAAATTCCACATCAACAACAGCAACAA
CAACAGCAGCAGCAGCAACAACAGCAGCAGCAACAACAGAATCAGCAGCA
ATTGCAGGTTCAGCAACAACATCAGTTGCAGCAGCAGTTTGTTAACCTAA
ACAGGAACTACGAGCAACAGATATCTGCCAATTTGGGTAGCCAACAACAT
GGGTTCGAGCACAACGGCGTGGGTGTGGGTGCTTCTAGTAGCGGAAATGA
GAACTGCTTTAGCCAGTATAATCTAGAAAACATCACCAGTGTGGACATGG
AGCTGGCCAAACTGCAGAATTTGCAACGCATCAACACGCTAAAGCTCCTG
CATGCCCAAGCTCAACAAATGCCGCTGATCAACCAGCTCCTGCAGAGCTA
TGCCGGCAACGCCATAGGCAGCGTCGGTGGAAGCAATCTTGGTAACTTGA
TGAGCGCAGGCGGATCATCACTGATGACAGAAATGGCGGGAAACGTTGGC
GGCATTATAACCACCAACGATGGCCACCTGGATCGCGTAGCTAAGTTCTA
TAAGAGTTCGGCTGCCCTGTGCGATGCCACATGCACATGGAGTGGACACC
TGCCGCCGCGTTCGCACCGTATGCTCAACTATTCTCCCAAGGTCTTCCTC
GGCGGGATTCCCTGGGATATTAGTGAGCAGTCGCTCATCCAGATCTTCAA
GCCATTTGGATCTATTAAAGTGGAGTGGCCCGGCAAGGAGCAGCAGGCGG
CTCAGCCCAAGGGTTATGTTTACATAATCTTTGAATCGGACAAGCAGGTC
AAGGCATTACTTTCGGCCTGTGTGCTTCAGGTGGATGATTCTCACTGTGG
TAGGAACTACTTCTTCAAAATCTCTTCGCGGCGTATTAAGTCCAAGGATG
TTGAAGTCATTCCTTGGATTATCGCTGACTCCAATTTTGTGCGATCCAGC
TCCCAGAAACTTGACCCAACGAAAACCGTGTTTGTGGGCGCACTGCATGG
AAAACTGACTGCCGAGGGCTTGGGAAATATAATGGATGATCTTTTCGACG
GCGTGCTGTATGCTGGTATAGATACGGACAAGTACAAGTACCCGATCGGA
TCGGGACGTGTGACATTTAGCAACTTTCGCTCCTACATGAAAGCTGTTTC
GGCCGCCTTTATCGAGATTAGGACCACGAAGTTCACCAAGAAGGTGCAGG
TGGATCCCTACTTGGAGGATGCCCTATGTTCCATATGCGGTGTGCAGCAC
GGTCCCTACTATTGTAGGGAATTATCGTGCTTCCGATACTTCTGCCGCAG
CTGCTGGCAATGGCAGCACAGCTGTGACATCGTCAAAAATCACAAGCCCT
TGACTCGCAACTCCAAGTCGCAGAGCCTGGTTGGCATCGGACCATCTTCG
TCGAATGTTTCGTTACCCTTCTCTGGCCAACGAAGTATCAGGGACAACAG
AATGGGGAACGGTCAGCATCAACAGCACCAGCAGCATCAGTACCAACAGC
AGAAACACCGTCAGCTGCAAGAATACTCGCAGCCCCACAGTCTCAACGTG
ATGGGAAACTCAGGAGCTGCCAATGCCGCTGCTACATCAATGGTAACTCT
TCAGCAGCGGCAAATTCACAAGGTGCGAATACAGCGTCAGCAGCATCAGG
CGATCGCAAGCTTTCTAGACCAT

BO28389.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
orb-RD 2742 CG10868-PD 1..2739 17..2755 13635 99.9 Plus
orb-RB 2742 CG10868-PB 1..2739 17..2755 13635 99.9 Plus
orb-RG 2748 CG10868-PG 239..2745 249..2755 12490 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
orb-RD 3258 CG10868-RD 302..3042 15..2755 13645 99.9 Plus
orb-RB 4251 CG10868-RB 302..3042 15..2755 13645 99.9 Plus
orb-RF 3079 CG10868-RF 321..2877 199..2755 12740 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23266962..23267680 1818..1100 3580 99.9 Minus
3R 32079331 3R 23269122..23269603 730..249 2410 100 Minus
3R 32079331 3R 23266280..23266665 2385..2000 1915 99.7 Minus
3R 32079331 3R 23265856..23266226 2755..2385 1840 99.7 Minus
3R 32079331 3R 23268063..23268297 1099..865 1175 100 Minus
3R 32079331 3R 23269751..23269984 248..15 1155 99.6 Minus
3R 32079331 3R 23266719..23266901 2001..1819 915 100 Minus
3R 32079331 3R 23268384..23268522 867..729 695 100 Minus
Blast to na_te.dros performed 2014-11-26 22:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2319..2731 865..1270 289 56.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2600..2902 909..1230 262 58.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2273..2642 872..1237 247 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6766..7125 909..1272 222 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2323..2536 2537..2751 217 58.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6810..6947 2534..2673 207 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1506..1601 2526..2625 157 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6824..6944 2528..2647 152 64 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1533..1587 904..959 151 76.8 Plus
roo 9092 roo DM_ROO 9092bp 1100..1171 913..984 134 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1517..1583 931..999 133 68.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6773..6903 865..1001 131 57.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6785 930..997 128 67.6 Plus
roo 9092 roo DM_ROO 9092bp 1071..1102 933..964 124 87.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2782..2848 906..963 116 71.6 Plus

BO28389.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-19 13:17:16 Download gff for BO28389.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RD 309..3042 22..2757 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:45:48 Download gff for BO28389.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RB 309..3042 22..2757 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:50:25 Download gff for BO28389.complete
Subject Subject Range Query Range Percent Splice Strand
orb-RB 309..3042 22..2757 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:50:25 Download gff for BO28389.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23269751..23269977 22..248 99   Minus
3R 23269122..23269603 249..730 100 <- Minus
3R 23268384..23268520 731..867 100 <- Minus
3R 23268063..23268294 868..1099 100 <- Minus
3R 23266962..23267680 1100..1818 99 <- Minus
3R 23266721..23266901 1819..1999 100 <- Minus
3R 23266280..23266665 2000..2385 99 <- Minus
3R 23265854..23266225 2386..2757 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:45:48 Download gff for BO28389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19095473..19095699 22..248 99   Minus
arm_3R 19094844..19095325 249..730 100 <- Minus
arm_3R 19094106..19094242 731..867 100 <- Minus
arm_3R 19093785..19094016 868..1099 100 <- Minus
arm_3R 19092684..19093402 1100..1818 99 <- Minus
arm_3R 19092443..19092623 1819..1999 100 <- Minus
arm_3R 19092002..19092387 2000..2385 99 <- Minus
arm_3R 19091576..19091947 2386..2757 99 <- Minus

BO28389.pep Sequence

Translation from 16 to 2773

> BO28389.pep
MLGVEKPYVVEPAMAVAQDSFEFGSNGDGSSTNSHTSNASSKDLGRLTSG
DGAQNFAQDSSANSIDQDSTDNTNSDCNPITLNDLLGLCGASTANEVVGT
GQTPSTSAPILGAGGGGRANGVTAGAATATGVGVGAGGTLPGPGVPSIQG
GGGGGVVGQQTNASCNTSAANPSASFGGNGSSSDVNNLLLASAAAAAAAA
AGDGAQLSANAAAYAPLTPSSTHSSASPGTKSNFDYFQFENVAQSNPLKA
FQRTNISFDCSAPLSPSTPTSIYNRSFHSSPLVSDSSNSSSGIGLSMDSI
NMFYNQQQQQQQPEQQGYTSLGNSMGSGLGLSLANASTRSNSPESQNSSN
STTEQNLLDMINLLSVNSNKIPHQQQQQQQQQQQQQQQQQQNQQQLQVQQ
QHQLQQQFVNLNRNYEQQISANLGSQQHGFEHNGVGVGASSSGNENCFSQ
YNLENITSVDMELAKLQNLQRINTLKLLHAQAQQMPLINQLLQSYAGNAI
GSVGGSNLGNLMSAGGSSLMTEMAGNVGGIITTNDGHLDRVAKFYKSSAA
LCDATCTWSGHLPPRSHRMLNYSPKVFLGGIPWDISEQSLIQIFKPFGSI
KVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSACVLQVDDSHCGRNYFF
KISSRRIKSKDVEVIPWIIADSNFVRSSSQKLDPTKTVFVGALHGKLTAE
GLGNIMDDLFDGVLYAGIDTDKYKYPIGSGRVTFSNFRSYMKAVSAAFIE
IRTTKFTKKVQVDPYLEDALCSICGVQHGPYYCRELSCFRYFCRSCWQWQ
HSCDIVKNHKPLTRNSKSQSLVGIGPSSSNVSLPFSGQRSIRDNRMGNGQ
HQQHQQHQYQQQKHRQLQEYSQPHSLNVMGNSGAANAAATSMVTLQQRQI
HKVRIQRQQHQAIASFLDH

BO28389.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
orb-PD 913 CG10868-PD 1..913 1..913 4732 100 Plus
orb-PB 913 CG10868-PB 1..913 1..913 4732 100 Plus
orb-PG 915 CG10868-PG 80..915 78..913 4332 99.9 Plus
orb-PA 915 CG10868-PA 80..915 78..913 4332 99.9 Plus
orb-PF 617 CG10868-PF 1..617 297..913 3226 100 Plus