Clone BO28392 Report

Search the DGRC for BO28392

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptCG42669-RA
Protein status:BO28392.pep: Imported from assembly
Sequenced Size:1459

Clone Sequence Records

BO28392.complete Sequence

1459 bp assembled on 2011-07-19

GenBank Submission: KX798429

> BO28392.complete
GAAGTTATCAGTCGACATGCCTACCACAATCAAGCGGCACAGTACAACCA
TTGTAATCAAATCATCCATTTCAGGAACCACCAACTCCCGTCAATCTCCA
CCAGCGTCGTCGGCGGAGGTGTCTTCAAGTGCAGCCGACAATTCCATGCA
CAGTGACGAGCGGTCCACGCCAAATGCAACGATAGATGCGGAATTCGAAC
CCTCATCCCTGTCGCTGGCTGAGCGACTGGCCTTCTTCAGCAATCTGTGC
GAGAGCGGCGGAGGAGGTGGGAGTACCAGTGCCGGTGGAAGGTACCGCAG
TCGCACCAGCAGCTATTCAAGGAGTCCGCCCGGCGATCGCACCACTCCCA
GGAGCAGCACCACCGCCAGCAGTGTCAGTATGACGCCCACGCCCATGGAT
TACTCTCCGATTCCCCACGACAAGGAGCCATCTAGTCTCACGCTGGAGAG
CATCATCGAGCCCGAGCAGGAGGAGGTCAAGGAGCAGGTGGACCAGGATG
AGGTCAAGTTGAGGAAGAAGGAGCCAGTCCAGAGGGAATCTTCCCAGCAC
AATGGCTTCCACGTGCTGACCAGGTCCGCCACCGAACCGCCGTCGTCCAC
CTCGCCCCTGCGCATCAGCATACGGACTGTGGGAAAGCTAGTCCTGCCCG
ATACCTTCCGCGGCGATCGCAACAATAACAGCAGTAGTAGAAGTGGGAGC
AACAGCTGGAGCAACACTTGCATGGTCAAGCTGCAGAGCTTGGAGCCCGT
TAGCCTGTCCGTTCATTCGCGCACCATTGGTAAGGTTAAGTCGCCATTCA
TTGAAAAGCAGCAGGAGAAACCACACACCGAGAAGCTAGCGAACGGAACC
AGCGACAGTGGCTCCGATTCGGGCAAGGAGAACTGCGCCTCCAACGAGCA
GGAACATCTGCAGCACCAGCAGTCGCAGGACGAGGATCGAGCTCCGCCCA
GGGTGTCCGAGATGCGGAGGAAAATCAGCCGACTGGTGCAACAACAGCAG
CCGCAACCACAGCCCGTCAATCGGCGGCACACCACCGAGATCACCTCCGT
GACCGTTGGAACGCGTTCGCCCAGTGTGGACGATCGCTTTGCCAAGTACT
TTGGTGTTAAGGAGAGCTGCAACAGCACGACCACCGTGCATAAAACGCAA
TCGCTGCCACCCAGCCAAGTTGAGGCCACCAATGCGCACGTGAAACTACC
GCAGATCACTACCGTGGTTTCCAAACGGCGCGAGCTGCTCAAGAGGACGC
GACCCCTGTCCATGGATCACTACTCCAGCGGCTGCACCAGTCCCACAGCC
ATGCCAAGTCCCAAGAGAGCACATTCGCCCGTCGGCCGGCGGAAGGCCGC
CATTTCCAGCATCGAGGACATTGAGGTCACGCCGGATGAACTCCGGGCCG
CTGGCAGGAACTTCAAGCTGTTGTACGGCGAGTTATTGGGCGCAAGCTTT
CTAGACCAT

BO28392.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG45186-RA 1428 CG45186-PA 1..1425 17..1441 7125 100 Plus
CG45186-RAD 10422 CG45186-PAD 9052..10419 74..1441 6840 100 Plus
CG45186-RAC 9348 CG45186-PAC 7978..9345 74..1441 6840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG45186-RA 2084 CG45186-RA 111..1535 17..1441 7125 100 Plus
CG45186-RAD 11244 CG45186-RD 9328..10695 74..1441 6840 100 Plus
CG45186-RAC 10679 CG45186-RC 8763..10130 74..1441 6840 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2463056..2464300 197..1441 6225 100 Plus
3L 28110227 3L 2461088..2461268 17..197 905 100 Plus
Blast to na_te.dros performed 2014-11-26 21:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2451 892..1036 147 60.1 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 647..723 746..669 117 62.8 Minus

BO28392.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-19 10:53:21 Download gff for BO28392.complete
Subject Subject Range Query Range Percent Splice Strand
CG42669-RA 111..1535 17..1443 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:41:46 Download gff for BO28392.complete
Subject Subject Range Query Range Percent Splice Strand
CG42669-RA 111..1535 17..1443 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:46:41 Download gff for BO28392.complete
Subject Subject Range Query Range Percent Splice Strand
CG45186-RA 111..1535 17..1443 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:46:41 Download gff for BO28392.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2463057..2464300 198..1443 99   Plus
3L 2461088..2461268 17..197 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:41:46 Download gff for BO28392.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2463057..2464300 198..1443 99   Plus
arm_3L 2461088..2461268 17..197 100 -> Plus

BO28392.pep Sequence

Translation from 16 to 1459

> BO28392.pep
MPTTIKRHSTTIVIKSSISGTTNSRQSPPASSAEVSSSAADNSMHSDERS
TPNATIDAEFEPSSLSLAERLAFFSNLCESGGGGGSTSAGGRYRSRTSSY
SRSPPGDRTTPRSSTTASSVSMTPTPMDYSPIPHDKEPSSLTLESIIEPE
QEEVKEQVDQDEVKLRKKEPVQRESSQHNGFHVLTRSATEPPSSTSPLRI
SIRTVGKLVLPDTFRGDRNNNSSSRSGSNSWSNTCMVKLQSLEPVSLSVH
SRTIGKVKSPFIEKQQEKPHTEKLANGTSDSGSDSGKENCASNEQEHLQH
QQSQDEDRAPPRVSEMRRKISRLVQQQQPQPQPVNRRHTTEITSVTVGTR
SPSVDDRFAKYFGVKESCNSTTTVHKTQSLPPSQVEATNAHVKLPQITTV
VSKRRELLKRTRPLSMDHYSSGCTSPTAMPSPKRAHSPVGRRKAAISSIE
DIEVTPDELRAAGRNFKLLYGELLGASFLDH

BO28392.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG45186-PA 475 CG45186-PA 1..475 1..475 2424 100 Plus
CG45186-PU 1519 CG45186-PU 1063..1519 19..475 2334 99.8 Plus
CG45186-PT 1877 CG45186-PT 1421..1877 19..475 2334 99.8 Plus
CG45186-PR 1702 CG45186-PR 1246..1702 19..475 2334 99.8 Plus
CG45186-PQ 1877 CG45186-PQ 1421..1877 19..475 2334 99.8 Plus