Clone BO28396 Report

Search the DGRC for BO28396

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:283
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptTER94-RC
Protein status:BO28396.pep: Imported from assembly
Sequenced Size:2512

Clone Sequence Records

BO28396.complete Sequence

2512 bp assembled on 2011-07-18

GenBank Submission: KX793951

> BO28396.complete
GAAGTTATCAGTCGACATGGATCATGATGGGGATACGAGGGACTTTATGC
GGGGATATCACAGCGAGCAGGATGAGAAAATGAAGCCGAAAGACTCGTTC
GATAAGCGTGAAGATCTGGCTACGGCGATCCTGAAGCGCAAGGACCGTCC
CAACCGACTGATTGTGGAAGAGGCGCAGAATGACGACAACTCTGTGGTGT
CGCTATCGCAGGCGAAGATGGATGAGCTGCAGCTCTTCCGTGGCGACACC
GTGATTCTGAAGGGCAAGCGCCGAAAGGAGACGGTGTGCATCGTGCTCTC
GGACGACACCTGTCCCGACGAGAAGATCCGCATGAACCGCGTGGTGCGCA
ACAACCTGTGCGTCCATCTTTCAGATGTGGTTTCCGTGCAGTCCTGCCCG
GACGTCAAGTACGGCAAACGGGTGCGCATCCTGCCCATCGACGAAAGCAC
CGAAGGCGTTACCGGCAACCTGTTCGAGATCTATCTGAAGCCGTACTTCC
TAGAGGCCTATCGGCCAATCCACATGGGCGACAACTTTATTGTGCGCGCC
GCCATGCGTCCTATTGAGTTCAAGGTGGTGCTGACCGACCCGGAGCCCTA
CTGCATCGTAGCTCCCGAGACTGTAATCTTCTGCGACGGTGATCCAATCA
AGCGCGAGGAGGAGGAGGAGTCCCTAAACGCCGTTGGCTACGATGATATC
GGTGGTTGCCGCAAGCAGCTGGCCCAGATCAAGGAGATGGTTGAGTTGCC
TTTGCGGCATCCATCGCTCTTCAAGGCCATTGGTGTGAAGCCACCGCGTG
GTATTCTTATGTACGGTCCCCCGGGTACCGGTAAGACCCTGATTGCCAGG
GCTGTGGCCAACGAGACCGGAGCCTTTTTCTTCCTGATTAACGGACCGGA
GATCATGTCCAAACTGGCCGGAGAGTCGGAATCGAATCTGCGTAAGGCCT
TCGAGGAAGCCGAGAAAAACTCGCCGGCTATCATCTTCATCGATGAGATC
GACGCTATTGCCCCCAAGCGTGACAAGACCCACGGTGAGGTGGAGCGTCG
CATTGTGTCGCAGCTTTTGACCCTGATGGATGGCATGAAGAAGAGCTCCC
ATCTGATCGTTATGGCTGCTACCAACAGGCCCAACTCCATTGACCCGGCC
CTGCGTCGCTTTGGACGTTTTGATCGTGAGATTGACATCGGCATTCCAGA
TGCCACTGGTCGGCTGGAGGTGCTGCGCATTCACACCAAGAACATGAAGC
TGCATGATGATGTTGACCTGGAGCAGATTGCTGCCGAATCCCACGGACAT
GTGGGCGCTGATCTGGCTTCACTCTGCTCTGAGGCTGCCCTTCAGCAAAT
CCGTGAGAAGATGGACCTCATCGATTTGGAAGACGATAAGATCGATGCCG
AGGTGCTGGCGTCGCTGGCCGTGACAATGGAGAACTTCCGCTACGCTATG
ACCAAGTCCAGTCCATCGGCGCTGCGTGAAACTGTTGTTGAGGTGCCCAA
CACCACCTGGACAGACATCGGCGGTCTGGAGAGCGTCAAGAAGGAATTGC
AGGAGCTGGTGCAATACCCAGTGGAGCATCCGGACAAGTTCTTGAAGTTT
GGCATGCAGCCCAGTCGCGGTGTCCTTTTCTACGGACCCCCTGGTTGCGG
TAAGACGCTGCTGGCCAAGGCCATTGCCAACGAGTGCCAGGCGAACTTCA
TCTCAGTCAAGGGTCCCGAGCTGCTGACCATGTGGTTCGGCGAGTCTGAG
GCCAACGTGCGCGACATCTTCGATAAGGCTCGCTCGGCGGCTCCTTGTGT
GCTCTTCTTTGACGAGCTGGACTCGATCGCCAAAGCCCGTGGCGGTAATG
TCGGCGATGCTGGCGGCGCCGCTGATCGTGTGATCAATCAGATCCTTACC
GAAATGGATGGCATGGGAGCCAAGAAGAATGTGTTCATCATCGGAGCCAC
CAATCGCCCGGACATTATCGATCCGGCCATCCTCCGTCCGGGCCGTCTGG
ATCAGTTGATCTATATTCCGCTGCCCGACGACAAATCGCGTGAGGCTATC
CTGAAGGCTAACTTGCGCAAGTCGCCGCTGGCCAAGGAAGTAGACCTTAC
CTACATCGCCAAGGTGACGCAGGGCTTCTCTGGCGCCGATCTGACCGAGA
TCTGCCAGCGGGCTTGCAAGCTGGCCATCCGACAGGCCATCGAGGCTGAA
ATTCGTCGCGAGAAGGAGCGCGCCGAAAATCAGAACTCCGCGATGGACAT
GGACGAGGACGATCCAGTGCCGGAGATTACCAGCGCCCACTTCGAGGAGG
CCATGAAGTTCGCTCGCCGTTCGGTGTCCGATAATGACATCAGGAAGTAC
GAGATGTTTGCCCAGACTTTGCAGCAGTCCCGTGGATTCGGACAGAACTT
CAGATTCCCCGGTCAAACCGGCAACACCTCAGGATCTGGTAACAACTTGC
CAGTTAACTCGCCCGGCGACAACGGCGACGATGATCTTTACAGTGCAAGC
TTTCTAGACCAT

BO28396.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-RC 2481 CG2331-PC 1..2478 17..2494 12255 99.6 Plus
TER94-RE 2478 CG2331-PE 1..2475 17..2494 12175 99.5 Plus
TER94-RA 2406 CG2331-PA 13..2403 104..2494 11805 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-RC 3058 CG2331-RC 96..2573 17..2494 12255 99.6 Plus
TER94-RE 3055 CG2331-RE 96..2570 17..2494 12175 99.5 Plus
TER94-RA 3016 CG2331-RA 141..2531 104..2494 11805 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9990657..9992696 209..2248 10080 99.6 Plus
2R 25286936 2R 9992763..9992917 2249..2403 760 99.4 Plus
2R 25286936 2R 9990470..9990574 108..212 525 100 Plus
2R 25286936 2R 9992981..9993074 2401..2494 470 100 Plus
2R 25286936 2R 9990298..9990389 17..108 460 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:53:52 has no hits.

BO28396.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 16:37:16 Download gff for BO28396.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 1..2478 17..2496 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:40:10 Download gff for BO28396.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 96..2573 17..2496 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:20 Download gff for BO28396.complete
Subject Subject Range Query Range Percent Splice Strand
TER94-RC 96..2573 17..2496 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:20 Download gff for BO28396.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9992984..9993074 2404..2496 97   Plus
2R 9992763..9992917 2249..2403 99 -> Plus
2R 9990660..9992696 212..2248 99 -> Plus
2R 9990471..9990573 109..211 100 -> Plus
2R 9990298..9990389 17..108 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:40:10 Download gff for BO28396.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5880489..5880579 2404..2496 97   Plus
arm_2R 5880268..5880422 2249..2403 99 -> Plus
arm_2R 5878165..5880201 212..2248 99 -> Plus
arm_2R 5877976..5878078 109..211 100 -> Plus
arm_2R 5877803..5877894 17..108 100 -> Plus

BO28396.pep Sequence

Translation from 16 to 2512

> BO28396.pep
MDHDGDTRDFMRGYHSEQDEKMKPKDSFDKREDLATAILKRKDRPNRLIV
EEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCP
DEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTG
NLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAP
ETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHPS
LFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKL
AGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQL
LTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRL
EVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMD
LIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTD
IGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLA
KAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDE
LDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDI
IDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKV
TQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDP
VPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRFPGQ
TGNTSGSGNNLPVNSPGDNGDDDLYSASFLDH

BO28396.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:00:59
Subject Length Description Subject Range Query Range Score Percent Strand
TER94-PC 826 CG2331-PC 1..826 1..826 4254 100 Plus
TER94-PE 825 CG2331-PE 1..825 1..826 4237 99.9 Plus
TER94-PA 801 CG2331-PA 5..801 30..826 4083 99.9 Plus
TER94-PD 759 CG2331-PD 1..759 68..826 3907 100 Plus
CG5776-PB 799 CG5776-PB 255..766 209..728 974 37.3 Plus