Clone BO28441 Report

Search the DGRC for BO28441

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:284
Well:41
Vector:pDNR-Dual
Associated Gene/Transcriptr-cup-RA
Protein status:BO28441.pep: Imported from assembly
Sequenced Size:1816

Clone Sequence Records

BO28441.complete Sequence

1816 bp assembled on 2011-07-01

GenBank Submission: KX796315

> BO28441.complete
GAAGTTATCAGTCGACATGAAGGACTCGAGTCAATCGGCGCCGGCAGGCC
TTTTGGTGGCAAATCTGAAGTCTTGGGAAACGTTCGACTGGCCGACGGAG
CAGCAGCGTTGGATCTACCGCAGTTGGGGTCAGTACTTTGCGCGGATGCG
GAAGAACACCTTTGCCCAGAAGTACTTCGACAAATGCATCACAGAGAATG
AGAGCACGGATCACAAGGCTCTTTATCTGCGCAGCAAATTCAAGAGATCG
GTGGCCCTGACGCAGGACGCATTGGAGGATAGTTTGAGGGCCATGGAGGT
AAGGCAGGCGTGGGACGCAAATGTGTCCATGGAGCTCGGAGATGCGCTCT
ACGATTTGAATCGGTTTGAGGAGAACAAGAGCCTGCTGCACGACAATGTC
CGTCGGCATGCGGGCACCGCTCTAAAGAGCTTCGAGAATCGCCTCGTGGT
AGTCGATGAGAATCTCAAGGATTGCACGGGCTTCAGCCTGGCCAACTTCT
TCATGGAGCATTCCGCGCAGCTGCCCGGCTTCTATGCCCATCAGCAGGAG
GAGCTTCGAAGGGCCGACAGGCGGCCGCTGTGGAAAATCCTCAAGGAGCG
AAAGGAGTGTGATGTCCAGAGCAGGATCGATCGCAAGGAGGTGATGCTCT
CCCCACTGGAAAGAGAGCGCAGGCGTCGCAAGACCAAGATATTTTATCAG
AACTATTTGGGTCGCAGCTGGACCGATTTTTTCTTTCTGAAAACACTTCG
CCGGCATCCCAACTGTCTTCTAGACAATCATTTCGGCTCCTCGGCGGACC
GCACCAAGTATCTTGAGTATGCGTTCCAGCGCCTTAAGACCTTCACACGG
ATGCTCCAGGCAAGGAGACCCATGTACAAGGAGTACTTCCATCGGAATCC
CCAGATAGAGGCTCGCATGCGGGATGCGAACTTGTTCCGGATCCAGTACC
AAACCAGGCGAAACATGGTGAGCATCCTGCGGACCATTAAGGTGCTGCGG
GGGCGGAATGATATCAAGCGCCTGCGCAAGTTTGTGGAGGAAGTGATGGG
CAGCTACGTGGTCATCAAGACGAATCGACTGATGCCCTGGAAGGCGGAGT
TCATGAACGAGGTGTACAACAATCTGGCCCTCAGTTTGTGCGAGGGATAC
CGCCTGCCGCCCACACGGGTCACGCCCTACGACAAGAGCGCCATGTGCCA
GCTGCTCAACATACCGGTGGCCAAGCCGCTGGAGCACACGGAGCTCATCT
TCGGGGATCGATCCACCTACTCCTATGCCGGCGCCGACAAACAGAGCACC
GATCGATTGGCAGACCAAAACCAAATCGAGTATCTGGAGAAACGACTTCT
CTTCGCCCGCCTGCCGATCGAAAGGAGCTACTTGCTCCATGAGCTGGCCG
ATCGGCATATGCAGAAGAACCACTTTGTGCAGAGCCTGTCCTACGCCCAG
AAGGCCATCGAGGAGGCCAGGGTATGCAATAGCCTGATCTGGGAGTTTCT
TAGCACCATGCTGATGGCCAAGTCACACGCGGTGCTCCACAAGTACGAGC
GCCAAACGGAGGTGCTCAACTCCGCCTACGAACTGGCCGCCCAGCTCAAG
TCGCCCCAACTGTGCACCTTCATCGAACTGTGCCGCATGCTCAACAAGGA
CTACATCACGTTGCGCAAGATGTCCCAACTGGTGACCACCAAACGGCTGC
GCACCAAAATCTCCAACAGGTCCAGTTTCCTCAGCTCACCCAACTGTTCG
CCCAACTTCTCGGAATTCAAAAAGGAAGAGTATGGTCATTTGGCCGCCGC
AAGCTTTCTAGACCAT

BO28441.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-RA 1785 CG10998-PA 1..1782 17..1798 8835 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-RA 2140 CG10998-RA 99..1880 17..1798 8835 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21024789..21025790 1018..17 4965 99.7 Minus
X 23542271 X 21023650..21024130 1798..1318 2375 99.6 Minus
X 23542271 X 21024400..21024700 1317..1017 1505 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:44:54 has no hits.

BO28441.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-01 14:59:15 Download gff for BO28441.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 99..1880 17..1800 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:08:44 Download gff for BO28441.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 99..1880 17..1800 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:26:29 Download gff for BO28441.complete
Subject Subject Range Query Range Percent Splice Strand
r-cup-RA 99..1880 17..1800 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:26:29 Download gff for BO28441.complete
Subject Subject Range Query Range Percent Splice Strand
X 21024789..21025790 17..1018 99   Minus
X 21024400..21024698 1019..1317 100 <- Minus
X 21023648..21024130 1318..1800 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:08:44 Download gff for BO28441.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20895816..20896817 17..1018 99   Minus
arm_X 20895427..20895725 1019..1317 100 <- Minus
arm_X 20894675..20895157 1318..1800 99 <- Minus

BO28441.pep Sequence

Translation from 16 to 1816

> BO28441.pep
MKDSSQSAPAGLLVANLKSWETFDWPTEQQRWIYRSWGQYFARMRKNTFA
QKYFDKCITENESTDHKALYLRSKFKRSVALTQDALEDSLRAMEVRQAWD
ANVSMELGDALYDLNRFEENKSLLHDNVRRHAGTALKSFENRLVVVDENL
KDCTGFSLANFFMEHSAQLPGFYAHQQEELRRADRRPLWKILKERKECDV
QSRIDRKEVMLSPLERERRRRKTKIFYQNYLGRSWTDFFFLKTLRRHPNC
LLDNHFGSSADRTKYLEYAFQRLKTFTRMLQARRPMYKEYFHRNPQIEAR
MRDANLFRIQYQTRRNMVSILRTIKVLRGRNDIKRLRKFVEEVMGSYVVI
KTNRLMPWKAEFMNEVYNNLALSLCEGYRLPPTRVTPYDKSAMCQLLNIP
VAKPLEHTELIFGDRSTYSYAGADKQSTDRLADQNQIEYLEKRLLFARLP
IERSYLLHELADRHMQKNHFVQSLSYAQKAIEEARVCNSLIWEFLSTMLM
AKSHAVLHKYERQTEVLNSAYELAAQLKSPQLCTFIELCRMLNKDYITLR
KMSQLVTTKRLRTKISNRSSFLSSPNCSPNFSEFKKEEYGHLAAASFLDH

BO28441.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
r-cup-PA 594 CG10998-PA 1..594 1..594 3102 100 Plus
CG7634-PA 579 CG7634-PA 24..563 20..560 1025 40.1 Plus
CG15128-PA 580 CG15128-PA 8..558 9..561 959 38.9 Plus
wa-cup-PB 580 CG10113-PB 13..549 8..552 842 36.1 Plus
p-cup-PA 538 CG12993-PA 44..529 91..574 623 32.4 Plus