Clone BO28445 Report

Search the DGRC for BO28445

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:284
Well:45
Vector:pDNR-Dual
Associated Gene/Transcriptscny-RD
Protein status:BO28445.pep: Imported from assembly
Sequenced Size:3148

Clone Sequence Records

BO28445.complete Sequence

3148 bp assembled on 2011-08-04

> BO28445.complete
GAAGTTATCAGTCGACATGCCCGTTTCGATGGCCGTATGCGAAACGGCGA
ATGTCGTCAACGCAGCGCTGCGCGAATCCCTTGGCGGCAACTCCTCCGCC
GGCTCGTCGACTGACCAGGCCAAGAGCGGCGAGGACACCAACGGCAGCCT
GCAAAATCACATCGTGGCCAATGCCAAACGCATCCTGATGGCCAAAATCG
AATACGAGGAGGTGCCCAACTACCACGAATCGGTGCTGGAGAACCTCAAG
TCCAAATATATTGTCATCAAGCCGGGAAATCCAGGCGCCATCAATGGCTT
TAGTGGCAAAAACAACACAGGCAAACTTGTGGGCGCAAATGGACATGACA
ATAACGGCGCCCGCAAGCAAGCGGAGCACCCGAACAATCAGTCGCACCAC
ATCAACCACCACAATCATCAGCATCCGACAAGCAATCCCAATGAGCTGCC
CAAGCCAAAGAGGGTCCTCTATCCGCGGGAGAACATACGCATTGGCTGGA
AGCAGTCGGAGCGCAAATGGCAGGTGGGCACGGGCATGATCAATGTGGGC
AACACCTGCTACCTCAACTCAACGCTTCAGGCGCTCCTGCACATACCCGC
CCTGGCCAATTGGCTCGTTTCGGAGCAGGCGCATCTGGCTGACTGCAATG
TGGCCGAACCTGGCAGCGGTTGCATCATTTGCGCCATGACCAAAACACTT
TTGGCCACCCAAAGCAATCAGTCGGCCGTCAGGCCCTTCCTCATCTACTC
GAAGCTAAAGCAGATCTGCAAACACATGGTCGTTGGTCGCCAAGAGGATG
CGCACGAGTTCCTGCGCTTCCTGGTCGAGGCCATGGAGCGGGCGTATTTG
ATGCGGTTTCGTAACTACAAAGAGCTGGATCAGTTGGTTAAGGAGACCAC
GCCGCTGGGACAGATCTTTGGCGGCTATCTGCGCAGCGAGGTGCGCTGTC
TGAGCTGCAACCATGTGTCCATTACGTTTCAGCACTTCCAGGATCTGTTG
CTCGACATCCGCAAGGCAGACTCCTTGGAGGATGCTTTCGAGGGGCACTT
TTCTCGCGAACGGCTAGAGGATATGGGCTACAAGTGCGAGGGATGCAAGA
AGAAGGTATCTGCCACAAAGCAATTCTCTTTGGAGCGTGCCCCAATCACG
CTTTGTATACAGCTGAAGCGATTCTCCATGATCGGCAACAAACTGACCAA
GCAGATCTCCTTCAAGTCACGCATAGATTTGAGCAAATACGCAGCCCGTT
CACAAGCGGCTCAGGCTCAACCGCTCACCTATCGCCTGGTGTCGATGGTC
ACTCACTTGGGAGCATCCCAGCACTGCGGTCACTACACGGCCATTGGCTC
CACGGATACGGGCAGCTTTTACAACTTCGACGACAGCTACGTGCGGCCAA
TCGCAATGCACAGTGTGTGCAACACAAATGCCTATATAATGTTTTTCGAA
CTGGACCTCTCACAGGCTGCCAGTCCGGCGGCCAACAGGCCCAATGGAGT
GCGTTTGACCAACGGACACAGCACAACGCCAGTGCCGGCGGCGACTGTGT
CTTCGCCTTCACCAACGCGTTTCATTGGTCCTCAACTGCCGGCGGGTGGA
GCAAACGGTTACACTAATGGCAATGCCCAGAAAACCGCCATCCAGTTCAA
GCAACAAAACCAGCAAAGTCCACAGAACGGACTCCAGCTGGGTACCGGAA
AGTTTCAGGACACTGCGAAGCCTCCACTGGTTGGCGCTCACGCTAAAGGC
GAAGCTACTTCAGCTCCCACTGCAAATGGTAACAAAAGTTCCTCCCCAAG
CAGCAACAGCAGCAGCAACCACAAATCAATAAACCAGCAACAATATCTGC
CAATTTCTTCGGATGATGAAGACATCGAGGATGAGATGAAGCCCAGACCA
ACGACAGCCCAGCTACCGAGCATGCCCAATATGACGGAGAATCATACGGA
GCCTAAGGCAAAGTCTCCTGTAAAGATTCAAGTAAAGACTCCCGTCAAAA
CGCCACTGAAAAGTCTTGTGCCCTACGAATCCGCATCTGAGGAGGAGGAG
GCGCCTCTACCGAATCCCCGCAAGCGTCCAAGTGGGGAGGATTCTAGCGA
GTCGGACCAAGAGTCTGGCCAGACCAATGGTCACAGTAAGACCAATGGCA
GCCACACCAACGGCTCAGCCTCGTCATCGGTTCACGTTAACAACAGCAAA
CAAAAGACTGATGCCATAGACGAGATATTCAAGAGCCTAAAAAAGTCCGC
AGACAGTGATGAGGACGACGATGAGGAGGAGCCCAGCATTCAGCTAACGA
ATGGCTGGCACCCACAGAAGCAATCACAGTCTCAAAGCAAAGCACCACCA
TCGCCAAAGACGCCACCCTCGCCAGCGGTCATCAAATCGAAAACGGGTAT
CTGGAAAGTTACGCGTAACGATGAGGTCGATGCCATCGAAGATGATGTTG
ACGTCGTGGTGGTGGAGGGATCGCCGGTGAAAATTCCGACGCCGAACAAG
AACCATCGCAATCCCTTCTCGAGTAGCAAGCCCTCCACGGACTCGCCCGC
AACGCCAGGCGCCAAGCGCCAAAAGTTGCTCAACGGCAGTGCGCTCAAGT
CGCACCAGCAGCCAAGGGTGGGCAATGGCTACCAGAGCAATGCCACCTCG
AATGGAAGCACCATCAATGAGCTGCTGAAGCAATCGTATCGTGGATACGG
CTCCCCCGTGCTCAGTTGGAATGGCAAGCCCGCGGAGCTCGAAAAGGAGC
TACTGGTGGATGCGCGTGAGCAGCGGCAGCGGGACATCGACGACGACGAA
GAGAACGAGATGGATCGTGGACGTCAGCGGAAGGTGAAGTCCGGTTCGGC
TAAGGGAAACAATGCTAGCAACAGCACGCCCGGGTACAATCCATTCCAGG
AGTACGAGGGCCAGAAGCGCTGGAACAAGAACGGCGGAGGTGGAGGATTT
CCGCGATTCTACAATCAGAACTATCGCCAGAACTTCCAGCAGCGCAACAA
GTTCAAGTTCAACCGCTTCGGAGGACCAGGAAGCGCCAAGTTCCAGCAGC
AGCGAGCCCTGCAACGACATCTGTCCGCCGGCGGTGGCTTCAGTCGGCGA
CAACCGTCGGCGCAGCAGCAGCAGCAAACCGCAAGCTTACTAGACCAT

BO28445.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
scny-RD 3117 CG5505-PD 1..3114 17..3130 15345 99.5 Plus
scny-RC 2847 CG5505-PC 61..2844 347..3130 13710 99.5 Plus
scny-RB 2907 CG5505-PB 121..2904 347..3130 13710 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
scny-RD 4417 CG5505-RD 597..3715 12..3130 15355 99.5 Plus
scny-RC 3637 CG5505-RC 152..2935 347..3130 13710 99.5 Plus
scny-RB 3512 CG5505-RB 453..3236 347..3130 13710 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5772431..5774076 1104..2749 8095 99.5 Plus
3L 28110227 3L 5771617..5772378 347..1108 3765 99.6 Plus
3L 28110227 3L 5775187..5775569 2748..3130 1885 99.5 Plus
3L 28110227 3L 5769598..5769933 12..347 1650 99.4 Plus
Blast to na_te.dros performed 2014-11-27 00:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2304..2415 1740..1850 153 64.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6851 1751..1850 146 65.3 Plus
roo 9092 roo DM_ROO 9092bp 1057..1147 1764..1852 143 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6744..6889 1775..1918 137 62 Plus
roo 9092 roo DM_ROO 9092bp 1050..1153 1717..1824 135 60.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6789 1779..1842 128 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1508..1619 1741..1848 127 59.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2767..2830 1781..1842 125 70.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2401..2451 1799..1847 124 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5634..5698 1783..1847 118 64.6 Plus

BO28445.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:49 Download gff for BO28445.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 602..3715 17..3132 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:38:01 Download gff for BO28445.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 481..3594 17..3132 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:13:08 Download gff for BO28445.complete
Subject Subject Range Query Range Percent Splice Strand
scny-RD 602..3715 17..3132 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:13:08 Download gff for BO28445.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5775189..5775569 2750..3132 98   Plus
3L 5772433..5774076 1106..2749 99 -> Plus
3L 5771618..5772375 348..1105 99 -> Plus
3L 5769603..5769933 17..347 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:38:01 Download gff for BO28445.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5768289..5768669 2750..3132 98   Plus
arm_3L 5765533..5767176 1106..2749 99 -> Plus
arm_3L 5764718..5765475 348..1105 99 -> Plus
arm_3L 5762703..5763033 17..347 99 -> Plus

BO28445.pep Sequence

Translation from 16 to 3148

> BO28445.pep
MPVSMAVCETANVVNAALRESLGGNSSAGSSTDQAKSGEDTNGSLQNHIV
ANAKRILMAKIEYEEVPNYHESVLENLKSKYIVIKPGNPGAINGFSGKNN
TGKLVGANGHDNNGARKQAEHPNNQSHHINHHNHQHPTSNPNELPKPKRV
LYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWL
VSEQAHLADCNVAEPGSGCIICAMTKTLLATQSNQSAVRPFLIYSKLKQI
CKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELDQLVKETTPLGQI
FGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSLEDAFEGHFSRERL
EDMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFSMIGNKLTKQISFK
SRIDLSKYAARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTDTGS
FYNFDDSYVRPIAMHSVCNTNAYIMFFELDLSQAASPAANRPNGVRLTNG
HSTTPVPAATVSSPSPTRFIGPQLPAGGANGYTNGNAQKTAIQFKQQNQQ
SPQNGLQLGTGKFQDTAKPPLVGAHAKGEATSAPTANGNKSSSPSSNSSS
NHKSINQQQYLPISSDDEDIEDEMKPRPTTAQLPSMPNMTENHTEPKAKS
PVKIQVKTPVKTPLKSLVPYESASEEEEAPLPNPRKRPSGEDSSESDQES
GQTNGHSKTNGSHTNGSASSSVHVNNSKQKTDAIDEIFKSLKKSADSDED
DDEEEPSIQLTNGWHPQKQSQSQSKAPPSPKTPPSPAVIKSKTGIWKVTR
NDEVDAIEDDVDVVVVEGSPVKIPTPNKNHRNPFSSSKPSTDSPATPGAK
RQKLLNGSALKSHQQPRVGNGYQSNATSNGSTINELLKQSYRGYGSPVLS
WNGKPAELEKELLVDAREQRQRDIDDDEENEMDRGRQRKVKSGSAKGNNA
SNSTPGYNPFQEYEGQKRWNKNGGGGGFPRFYNQNYRQNFQQRNKFKFNR
FGGPGSAKFQQQRALQRHLSAGGGFSRRQPSAQQQQQTASLLDH

BO28445.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
scny-PD 1038 CG5505-PD 1..1038 1..1038 5455 100 Plus
scny-PC 948 CG5505-PC 21..948 111..1038 4894 100 Plus
scny-PB 968 CG5505-PB 41..968 111..1038 4894 100 Plus
scny-PH 976 CG5505-PH 1..911 1..911 4772 100 Plus
scny-PG 976 CG5505-PG 1..911 1..911 4772 100 Plus