Clone BO28446 Report

Search the DGRC for BO28446

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:284
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG15483-RA
Protein status:BO28446.pep: Imported from assembly
Sequenced Size:1255

Clone Sequence Records

BO28446.complete Sequence

1255 bp assembled on 2011-06-29

GenBank Submission: KX797139

> BO28446.complete
GAAGTTATCAGTCGACATGTTTCGAATCTCTGGCCTTCTGAGTTCACTCG
TAGTCCTTACTTTTGTTCTGGAAATCAGTTGCCTGGAGAATGGCACCCTG
GCCAAGCTGAAAAAGTTTGTGAACTGTGAGTCTAAGGCTTACAAGTCCAG
CAATGCGATCTACAAGGATTACTGGGTGCTGGAGAACTATGTAATGGCTG
ATCACGGCGATATTCCGTGCTATTCGAATGTGACCTACACCACCCATGCG
GACTATACGTATCTGGATAATGTGGTGCCGCTCCTGGAACGCTGGCGATC
GCCCCTCAGCCTGGCCATATATGCGCCTGGCACGGACTTCGAGCCCACTA
TACACAGCATTTTGTACCTGCTGCAGTGCCATCCTGGCCACGACCTGGTT
CGCCAGCTGTGCAGCATTCATTTGTACTTCGATGTGGAGCACTTGCCCCA
GGTGGTTCTGCCACCCGAAACGACTCTAAGGGAGCCAGCCAACTGTAGTG
GACCACCGCCATATGAGAATGTCGTTAAAGGGAACATGTACAGGTCTCGA
AACACACTGGATTATCCCGTCAATATGGGACGCAACGTTGCACGCCGGGC
TTCGCTGACGCACTACGTCCTGGCCTCGGACATCGAGCTCTATCCCACGC
CCGGATTGGTGCCCGACTATATGCATTTCCTTGGCCGCCAAGTGATTGGA
ATTCCAGGACAGCAGCCTACTTCGCCGTTGGTCCATGTACTGCGGATTTT
CGAGGTAATGGCCAATGTATCTGTACCGAACACCAAGCCAGAGTTGCAAG
AGATGTTGAAGTCGGGCGAAGCTGTGCCATTTCACATGGACATCTGTGAG
GCGTGCCATAGGGGACCCAACCTGGAGGAGTGGATAAATGCGAGCGTTGT
GTCCAAGGAACTGAATGTCTTCAATGTTGGCCACCGCTCGGAAAATAACA
ACAATTGGGAGCCAATATTTTTGGGCACCGTCGAGGATCCTCCATACGAT
GAGCGATTAACGTGGGAGGGTCAACGGGACAAGATGACCCAGGCGTATGC
CATGTGCGTTCTGGACTACGAGTTCCATATCCTGGACAACGCCTTCCTGG
TCCATAAGCCCGGCATCAAACAGCCAGGCAATCGTAAGGAGATCTTCCCT
CAAGCCCGCCGAACCAATGGGCTTATCGATAAAAAGATCTCCAGGGAGAT
GCGGATGATGTACGGTTCTCGGAATGGTTGTGTTATTGCAAGCTTTCTAG
ACCAT

BO28446.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-RA 1224 CG15483-PA 1..1221 17..1237 5985 99.3 Plus
CG9171-RG 1635 CG9171-PG 1408..1514 1013..1119 250 82.2 Plus
CG9171-RF 1635 CG9171-PF 1408..1514 1013..1119 250 82.2 Plus
CG9171-RG 1635 CG9171-PG 579..756 172..349 200 74.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-RA 1382 CG15483-RA 49..1269 17..1237 5985 99.3 Plus
CG9171-RG 3950 CG9171-RG 1999..2105 1013..1119 250 82.2 Plus
CG9171-RF 3736 CG9171-RF 1785..1891 1013..1119 250 82.2 Plus
CG9171-RG 3950 CG9171-RG 1170..1347 172..349 200 74.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12761116..12761792 693..17 3340 99.6 Minus
2L 23513712 2L 12760459..12761004 1237..692 2655 99.1 Minus
2L 23513712 2L 5770385..5770562 349..172 200 74.2 Minus
2L 23513712 2L 5769437..5769501 1119..1055 190 86.2 Minus
Blast to na_te.dros performed on 2014-11-26 16:41:25 has no hits.

BO28446.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-29 16:21:13 Download gff for BO28446.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 55..1269 23..1239 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:13 Download gff for BO28446.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 55..1269 23..1239 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:25:10 Download gff for BO28446.complete
Subject Subject Range Query Range Percent Splice Strand
CG15483-RA 55..1269 23..1239 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:25:10 Download gff for BO28446.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12761118..12761786 23..691 99   Minus
2L 12760457..12761004 692..1239 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:13 Download gff for BO28446.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12761118..12761786 23..691 99   Minus
arm_2L 12760457..12761004 692..1239 98 <- Minus

BO28446.pep Sequence

Translation from 16 to 1255

> BO28446.pep
MFRISGLLSSLVVLTFVLEISCLENGTLAKLKKFVNCESKAYKSSNAIYK
DYWVLENYVMADHGDIPCYSNVTYTTHADYTYLDNVVPLLERWRSPLSLA
IYAPGTDFEPTIHSILYLLQCHPGHDLVRQLCSIHLYFDVEHLPQVVLPP
ETTLREPANCSGPPPYENVVKGNMYRSRNTLDYPVNMGRNVARRASLTHY
VLASDIELYPTPGLVPDYMHFLGRQVIGIPGQQPTSPLVHVLRIFEVMAN
VSVPNTKPELQEMLKSGEAVPFHMDICEACHRGPNLEEWINASVVSKELN
VFNVGHRSENNNNWEPIFLGTVEDPPYDERLTWEGQRDKMTQAYAMCVLD
YEFHILDNAFLVHKPGIKQPGNRKEIFPQARRTNGLIDKKISREMRMMYG
SRNGCVIASFLDH

BO28446.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG15483-PA 407 CG15483-PA 1..407 1..407 2192 100 Plus
CG9171-PG 544 CG9171-PG 171..544 30..407 1046 50.8 Plus
CG9171-PF 544 CG9171-PF 171..544 30..407 1046 50.8 Plus
CG9171-PE 544 CG9171-PE 171..544 30..407 1046 50.8 Plus
CG9171-PD 544 CG9171-PD 171..544 30..407 1046 50.8 Plus