Clone BO28477 Report

Search the DGRC for BO28477

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:284
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG6479-RB
Protein status:BO28477.pep: Imported from assembly
Sequenced Size:1648

Clone Sequence Records

BO28477.complete Sequence

1648 bp assembled on 2011-07-01

GenBank Submission: KX794336

> BO28477.complete
GAAGTTATCAGTCGACATGCTCCTCAGCTCGCCGCTGAGTAAAAACCCAG
TGGTGCAGCGCAGCCTGGACTTGCGATTGCAGGGCGCCCAAGCGCGGCAT
TACCTCAAGTGGTGCTCCATAAATGTGGTGCTGCTGTCGCTACTCCTCTT
CGACCTCTGGCAGGCATGTCGGTCCGCCTACAGGACCTACTGGTTCCTGG
CGGAGTGCACCATTACGACCCTGATTGGCCTAAGTGCACTCGCCTGCTTC
GGCAAGTATTTGTGGTTATGGTTTGGTGGTGACCAAGTTACGGGTAGCGA
TATCCAAAAGTGGCTGCTTGATGGCAAGGCAGAGAACTCTTTTCGTACAG
TTTGCTCCCGAGCCGTGATGAAACCACGCAGCTACGAACCGGATAGCGAT
ATAGAGGACGACATACCCATCATCAACTGGCACTCCTCCTTCGAGGACTC
CTGCTGGGGCTCGCAATCCATGCGCCGCAGCCCCAGTCCCACAAGGACGC
CGCAGCAGACGAAACAAAACACCTCTTACAACTCCTCGATGGTTCGAAAC
AACTCGCTGAATGCCAGCAATCTGAGCAACGAGTCTACCTATATGTCCCC
GTATGCGGAGGTGCGACGCGATGACTTCATGACCGATACACGAAAGTTGA
CCAGTCTAATGAAGCAGGCGGATCGGGAGCGCAGCATGATGGACAGCTCG
GATACACCCAATGTGCAGAGCATGGGATCGGCCAACTCCTTCTGGAATTA
CTGCAACAATGCGGCCTATATGCTCAAGACCACCATCTATCAACTATCGC
CACCTCCGGCTGTTTCTACGGAAAATGCTCCCACCTCGATTGAGGAGTTT
GGCGGTATTCAGTTTAGGGACAGCAATTCGGAGGTCATCAAGCGCATATC
CACGGACAAACTGTCGCAATATGTGGCCAACCTAAGATTTTGGATTTCTA
CGACCATACTTCAGCGTTTGGTCAAAGAGATCAATTATGTGGACGATGTT
TTCCGCCAGCGAGCTCTGATTGACATTAAAATTGGATCTGTGAGTGTAGA
GAGATTACGCAAAACAGCCGAGAACCAGCAGTTCGTGCAGACGTGTGCGC
CCATGTTGCCCATGCTCTTACCTTTCCTGGACACCTTCAGCAACCAGGAA
TACCTGGTGCAGCGCATCAAGGAGCTTGCGCAGGGCTCTTGCATAGCTGA
CTACCGCTGGTACTCGGGCAAAACACACAACGGTCAGCAGCGGGACGAGC
ATTTGCCCACCGATGCAGCTATAATATTCCATTTATTTTGCGTGTACTTG
GATAGCCAGTTGATGCCGTTGCCGCAGGGCGGCGGACGACCCTTTCACTC
CCGCTACGTGTTAATTCGCGACGAGAAGAGCTCGACCAAGGACGTGGTGA
ACGCAGTTCACAACAAGGCCCACTGCGCCATTTTAAGTACCGGCAACCCA
CTTAACCCTAAATTTAACTTTATCAGCGACAAAGAACTACACAACTGCGT
CTACGATAGGAATAACCTGTTCTACGTTATCATACAGTTCCTAATTTATA
TGCGACAGCACCAGGACTCTGCTCTGGAGTGCGTAAATCTTGGCAAGAGT
GGTATCAACATCATGTGCGTCATCGAAGACGCAAGCTTTCTAGACCAT

BO28477.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-RB 1617 CG6479-PB 1..1614 17..1630 8040 99.9 Plus
CG6479-RA 1629 CG6479-PA 23..1626 27..1630 7990 99.9 Plus
CG6479-RC 1611 CG6479-PC 23..1608 27..1630 7685 98.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-RB 1791 CG6479-RB 26..1639 17..1630 8040 99.9 Plus
CG6479-RA 1861 CG6479-RA 106..1709 27..1630 7990 99.9 Plus
CG6479-RC 1843 CG6479-RC 106..1691 27..1630 7685 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17338129..17338738 940..331 3035 99.8 Minus
3L 28110227 3L 17337324..17337683 1630..1271 1785 99.7 Minus
3L 28110227 3L 17337743..17338072 1270..941 1650 100 Minus
3L 28110227 3L 17338796..17339111 332..17 1580 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:42:46 has no hits.

BO28477.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-01 14:18:51 Download gff for BO28477.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 26..1639 17..1632 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:47 Download gff for BO28477.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 26..1639 17..1632 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:25:40 Download gff for BO28477.complete
Subject Subject Range Query Range Percent Splice Strand
CG6479-RB 26..1639 17..1632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:25:40 Download gff for BO28477.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17338796..17339111 17..332 100   Minus
3L 17338129..17338736 333..940 99 <- Minus
3L 17337743..17338072 941..1270 100 <- Minus
3L 17337321..17337683 1271..1632 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:47 Download gff for BO28477.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17331896..17332211 17..332 100   Minus
arm_3L 17331229..17331836 333..940 99 <- Minus
arm_3L 17330843..17331172 941..1270 100 <- Minus
arm_3L 17330421..17330783 1271..1632 99 <- Minus

BO28477.pep Sequence

Translation from 16 to 1648

> BO28477.pep
MLLSSPLSKNPVVQRSLDLRLQGAQARHYLKWCSINVVLLSLLLFDLWQA
CRSAYRTYWFLAECTITTLIGLSALACFGKYLWLWFGGDQVTGSDIQKWL
LDGKAENSFRTVCSRAVMKPRSYEPDSDIEDDIPIINWHSSFEDSCWGSQ
SMRRSPSPTRTPQQTKQNTSYNSSMVRNNSLNASNLSNESTYMSPYAEVR
RDDFMTDTRKLTSLMKQADRERSMMDSSDTPNVQSMGSANSFWNYCNNAA
YMLKTTIYQLSPPPAVSTENAPTSIEEFGGIQFRDSNSEVIKRISTDKLS
QYVANLRFWISTTILQRLVKEINYVDDVFRQRALIDIKIGSVSVERLRKT
AENQQFVQTCAPMLPMLLPFLDTFSNQEYLVQRIKELAQGSCIADYRWYS
GKTHNGQQRDEHLPTDAAIIFHLFCVYLDSQLMPLPQGGGRPFHSRYVLI
RDEKSSTKDVVNAVHNKAHCAILSTGNPLNPKFNFISDKELHNCVYDRNN
LFYVIIQFLIYMRQHQDSALECVNLGKSGINIMCVIEDASFLDH

BO28477.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG6479-PB 538 CG6479-PB 1..538 1..538 2840 100 Plus
CG6479-PA 542 CG6479-PA 9..542 5..538 2823 100 Plus
CG6479-PC 536 CG6479-PC 9..536 5..538 2775 98.9 Plus