Clone BO28479 Report

Search the DGRC for BO28479

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:284
Well:79
Vector:pDNR-Dual
Associated Gene/Transcriptqua-RB
Protein status:BO28479.pep: Imported from assembly
Sequenced Size:2698

Clone Sequence Records

BO28479.complete Sequence

2698 bp assembled on 2011-07-18

GenBank Submission: KX794180

> BO28479.complete
GAAGTTATCAGTCGACATGGAGCTATCGCTGTCACCAAAAGAAACGGAGA
TCCGTCCCAACACCATTCCGGACTTAAAGGTGGATGCCACATTTCGGAAG
GTGGCTAAACATGCGATTACCTTTGCGATTTGGAAGATAGACGAGGATCG
CCTGGAGGCGGTACAAAGATCACATTATGGCACCTTCTACGATAGCTGCG
CCTACATTATCTATGCAGCAAGTTTGTCGGGGCATTATGCCAATCACGAA
ACCATCACACGCGAACAGAAGCCGAATGTGAGTCTTGAGCGATATATCCA
CTACTGGCTGGGCAAGAATGTTAGCGAGCAGAATCGATCCAATGTTGTTC
ATAAAATCCAGGAGCTGGACTCGTATCTGGGAAACATATCCTCTATTTAC
CGAGAGACCCAGAATCTGGAGAGTGCGAGATTCCTTTCGTATTTCAAGAA
GGGTTACGATGTTCGATCGGGAGCACTAATAAGCGCGCCCCAGAGGCCAC
GACTTTTTCAATTGTACGCCCGCAAATGGTTGCGATCCATTGAGGTGGCC
ACCATCGATTGGTCGCACTTTAACTCGGATTACGTAATGGTCCTGCAAAC
GGATAATCTTACCTACGTCTGGATAGGGCGCTCCAGTTCAGGAATTGAAC
GACGAAGTGCCCTCGACTGGGTCCAAAAGCACTGCAGTGGATCGCCAATC
ACTATAGTCGATGATGGATATGAGCAGGCCATGTCCCAGGAGCACAAGGA
GCTGTGGAACACCATGCTTCCGCTAAAGAAACGCATGGTCTGTCAGGCCA
GTCAGTTGGTCAGCGAATACGCCGACTACAATAGCAATAAGTTCCGCATC
TATAAGTGCAATCAACGGGGAAGGCTGCACCTGGATCAATTGGATGTGGG
CATGCCAGCAAAAGATGATCTAAGCGATGCCCATGGAGTCTATTTACTGG
ACAACTACGGCCAGAGTATTTGGTTGTGGGTAGGAGGCCAGGCACCGCAG
GCAGATGCCCTTTCTGCCATGGGAAATGGGAGAGCTTTTGTTAAAAAGAA
GAAATATCCGGATAATACGTTGGTGGTGCGTGTCCTCGAGGGTCACGAGC
CCGTGGAGTTTAAGCGTCTCTTTGCCAACTGGTTAAATGTTTGGCAGGAG
AACACCAGGGGACATAAGCCAGTGTCCACAAAGTTTGGAAAGCTAGATGC
CCATTCCCTATGCGAACGCCCTAAAATGGCTGCAGATACACAGCTCGTTG
ATGATGGCAGGGGTGAAAGAGTAATCTATCGTGTCTTCGGAGATCAGGTG
CAAGAGGTGCCCATCTCAAAAACGGTTGTGTTCACCACCAATGCCAGTTT
CGTGGTCAAGTACAGCGTGCAGTGCGCCACCGTTGTTCCCGCAGATTTGG
CCTCCGTTGGCATTAAAACAATCATCTACCAGTGGAATGGTTCGGAGGCC
TCTGTAGAGTCCATTTCCCGGGCGGACAAGTTCGCCAAGGCCAGTTTTGA
TGGGCTCAAGGAGCCTGGAATGTTTGTACAGCTCTATGAGTTCGATGAAC
CACCGCACTTCCTTCAGATCTTCGAGGGAAAACTTATTATCAGGCGCGGT
CAGCGTACCGAGATGCCTTACAATGGTAACTCCAATGCCTTGCTGGACAC
CTTTCTGCTGAAAGTTTATGGCGATGCTAGCTACAATGCCAAGGCTGTGG
AGGAGACACATCTGTCATCGATCAGCTCCAAAGATTGCTATGTGATCAAA
ACGAATCATGTTTGGGTGTGGTGCGGGCAAAGTAGCACGGGAGATGCCCG
CGAGATGGCCAAAGCAGTGGGAGCTCTGATGGGGGAAAACTCTCTGGTCC
TCGAAGGCAAGGAAAGTAAGGAGTTCTGGCAATCGGTGGCCATGTACTTC
AACCAAACTCTAGTGATCAACGGAAATGGGAACTCATGTTCCAGCAGCAC
CAGTAGCAGCAGTGGCGCCGGCAGCATGTGCAATGGTAGCTCCAATGGTG
GTAACATTTCACCCACTCTCAGCAATAATTGTTACCTAAACACCAGTGTT
CCGAGTAAACCGAGACCTCCTGTACAACTATTTCTGGTATGGTGGCAACA
GAGTTCGCTGAGATACGAGGAGATTCTCGGATTCGATCAGCAGGATCTCA
GTTCGGATTGCACCTATATTCTGGACACTGGGAGCCTCACCTACGTCTGG
CTGGGATCGCAGGCCCCAAACCAGGAACGCTACACAGCGATTGCCCAAAG
TTATGTCCAAAATGCTCCATTCGGACGCAGATCAGCGACAGCGTTGGCCG
TGGTCAGGCAGTTTCAGGAGCCAAATGTTTTCAAGGGATTCTTCGAGTCC
TGGCAAAACGATTACGGCAAGAACTTCCATTCCTACGAGAAAATGCGCAA
GGATCTGGGAAATAAAGTGACCAGCAATTGTTGCTTCGCAAGCGAAGGAT
CGGCTCTAATCCTGAACAACAGACAGAAGGACTTTGATGGTCACAAAAAG
TATCCATTAACCGTGCTCATCCAGGAAATGGATATGCTGCCACCAGATAT
TAATCCGCTCAAGAGGGAGGTTCACCTAACACACGATGATTTTGTGTCAG
TGTTTAATATGTCCTTTTATGAATTTGACGAGCTGCCGAAATGGAAGAAA
ATGGAGCTGAAAAAGCAATTCAAGCTTTTTGCAAGCTTTCTAGACCAT

BO28479.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
qua-RB 2667 CG6433-PB 1..2664 17..2680 13320 100 Plus
qua-RA 2664 CG6433-PA 27..2661 46..2680 13175 100 Plus
qua-RC 2679 CG6433-PC 1..2676 17..2680 13165 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
qua-RB 3306 CG6433-RB 483..3148 15..2680 13330 100 Plus
qua-RC 3318 CG6433-RC 483..3160 15..2680 13175 99.6 Plus
qua-RA 3266 CG6433-RA 474..3108 46..2680 13175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17487402..17488403 2371..1370 5010 100 Minus
2L 23513712 2L 17488457..17489369 1372..460 4565 100 Minus
2L 23513712 2L 17489693..17489903 256..46 1055 100 Minus
2L 23513712 2L 17489431..17489633 459..257 1015 100 Minus
2L 23513712 2L 17487138..17487339 2571..2370 1010 100 Minus
2L 23513712 2L 17486964..17487076 2680..2568 565 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:54:34 has no hits.

BO28479.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 16:37:16 Download gff for BO28479.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 479..3142 17..2682 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:40:29 Download gff for BO28479.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 485..3148 17..2682 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:36 Download gff for BO28479.complete
Subject Subject Range Query Range Percent Splice Strand
qua-RB 485..3148 17..2682 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:45:36 Download gff for BO28479.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17491802..17491831 17..46 100   Minus
2L 17489693..17489902 47..256 100 <- Minus
2L 17489431..17489633 257..459 100 <- Minus
2L 17488457..17489369 460..1372 100 <- Minus
2L 17487402..17488400 1373..2371 100 <- Minus
2L 17487140..17487337 2372..2569 100 <- Minus
2L 17486962..17487074 2570..2682 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:40:29 Download gff for BO28479.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17491802..17491831 17..46 100   Minus
arm_2L 17489693..17489902 47..256 100 <- Minus
arm_2L 17489431..17489633 257..459 100 <- Minus
arm_2L 17488457..17489369 460..1372 100 <- Minus
arm_2L 17487402..17488400 1373..2371 100 <- Minus
arm_2L 17487140..17487337 2372..2569 100 <- Minus
arm_2L 17486962..17487074 2570..2682 98 <- Minus

BO28479.pep Sequence

Translation from 16 to 2698

> BO28479.pep
MELSLSPKETEIRPNTIPDLKVDATFRKVAKHAITFAIWKIDEDRLEAVQ
RSHYGTFYDSCAYIIYAASLSGHYANHETITREQKPNVSLERYIHYWLGK
NVSEQNRSNVVHKIQELDSYLGNISSIYRETQNLESARFLSYFKKGYDVR
SGALISAPQRPRLFQLYARKWLRSIEVATIDWSHFNSDYVMVLQTDNLTY
VWIGRSSSGIERRSALDWVQKHCSGSPITIVDDGYEQAMSQEHKELWNTM
LPLKKRMVCQASQLVSEYADYNSNKFRIYKCNQRGRLHLDQLDVGMPAKD
DLSDAHGVYLLDNYGQSIWLWVGGQAPQADALSAMGNGRAFVKKKKYPDN
TLVVRVLEGHEPVEFKRLFANWLNVWQENTRGHKPVSTKFGKLDAHSLCE
RPKMAADTQLVDDGRGERVIYRVFGDQVQEVPISKTVVFTTNASFVVKYS
VQCATVVPADLASVGIKTIIYQWNGSEASVESISRADKFAKASFDGLKEP
GMFVQLYEFDEPPHFLQIFEGKLIIRRGQRTEMPYNGNSNALLDTFLLKV
YGDASYNAKAVEETHLSSISSKDCYVIKTNHVWVWCGQSSTGDAREMAKA
VGALMGENSLVLEGKESKEFWQSVAMYFNQTLVINGNGNSCSSSTSSSSG
AGSMCNGSSNGGNISPTLSNNCYLNTSVPSKPRPPVQLFLVWWQQSSLRY
EEILGFDQQDLSSDCTYILDTGSLTYVWLGSQAPNQERYTAIAQSYVQNA
PFGRRSATALAVVRQFQEPNVFKGFFESWQNDYGKNFHSYEKMRKDLGNK
VTSNCCFASEGSALILNNRQKDFDGHKKYPLTVLIQEMDMLPPDINPLKR
EVHLTHDDFVSVFNMSFYEFDELPKWKKMELKKQFKLFASFLDH

BO28479.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:01:01
Subject Length Description Subject Range Query Range Score Percent Strand
qua-PB 888 CG6433-PB 1..888 1..888 4699 100 Plus
qua-PC 892 CG6433-PC 1..892 1..888 4680 99.4 Plus
qua-PA 887 CG6433-PA 10..887 11..888 4651 100 Plus
Gel-PL 740 CG1106-PL 16..740 38..801 465 24.8 Plus
Gel-PA 740 CG1106-PA 16..740 38..801 465 24.8 Plus