Clone BO28495 Report

Search the DGRC for BO28495

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:284
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG4390-RB
Protein status:BO28495.pep: Imported from assembly
Sequenced Size:1024

Clone Sequence Records

BO28495.complete Sequence

1024 bp assembled on 2011-09-14

GenBank Submission: KX795582

> BO28495.complete
GAAGTTATCAGTCGACATGGGAAGAAATTTCCTTCGTCTGCCCAGTGTGA
GTGGTAGAAGCTCATTCGTATATTCCATAGTCGCCTGTTCAAATCTTCCC
AAGCGACGGAGCATTGTGCTCAGTTTTGGCCACATTATGACCGAGAACAT
GACGCTCGAACAGCTGTCCGCAAATAAGTGCTTCGAGGGCGAGCAACGCG
TGTATCGCCATCGCTCGGACACCTTGAAGTGCGACATGACCTTTGGCGTC
TTCCTGCCGCCGGCCGCTTTGGAGGGTAAACCGTGTCCGGTGCTGTTCTT
CCTCAGCGGACTGACCTGCACGCATGAGAACTTCATCCAGAAGAGCGGAT
TCCAGCAGCACGCCGCCCGCCACAACCTGATCGTCGTCAATCCGGACACT
TCGCCCAGGGGCGTGGAAATTGCCGGCCAAGATGATGCATACGACTTTGG
AAGCGGGGCTGGATTCTATGTGGATGCAAAGGAGGAGCCGTGGTCGAAGC
ACTACAAGATGTACAGCTATGTGACCCAGGAGCTGGTGGATGTGGTCAAT
GCCAATCTGCCCGTGGTTCCCGGTAAACGCGGTATATTCGGCCACAGTAT
GGGCGGCCACGGAGCCCTGATCTGCGCGCTTAAGAATCCCGGGCTGTACC
AGTCGGTGTCCGCTTTTGCGCCGATTGCCAATCCCACCGAGTGCCCGTGG
GGCAAGAAGGCCTTTGCCGGCTATCTGGGCTCCAATCCGGATGACTGGGC
CCTGTGGGATGCCACGCATCTGGTGTCGCAGTACGAGAGCACTCCGCAGG
AGCTCTTCATCGACCAAGGTGCAGCAGACAACTTCCTGGCCGGCAAGCAG
CTGCTGCCGGAGAACCTGCTGGCTGCCGCAGATGGCAACGATCACATCCA
GACCATCTTCAAGCAGCGCGAGGGATACGATCACAGCTACTTCTACATCG
CCACGTTCGTCGCCGAACACATCGCCTACCATGCCGCCCTGCTCACAGCT
TCCGCTGCAAGCTTTCTAGACCAT

BO28495.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-RB 993 CG4390-PB 1..990 17..1006 4935 99.9 Plus
CG4390-RA 861 CG4390-PA 1..858 149..1006 4275 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-RB 1141 CG4390-RB 56..1045 17..1006 4935 99.9 Plus
CG4390-RA 1006 CG4390-RA 50..910 146..1006 4290 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20056514..20057376 1006..144 4300 99.9 Minus
3R 32079331 3R 20059567..20059695 145..17 645 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:14:12 has no hits.

BO28495.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:15 Download gff for BO28495.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 71..1060 17..1008 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:33 Download gff for BO28495.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 71..1060 17..1008 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:06:21 Download gff for BO28495.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 56..1045 17..1008 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:06:21 Download gff for BO28495.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20059567..20059695 17..145 100   Minus
3R 20056511..20057374 146..1008 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:33 Download gff for BO28495.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15885289..15885417 17..145 100   Minus
arm_3R 15882233..15883096 146..1008 99 <- Minus

BO28495.pep Sequence

Translation from 16 to 1024

> BO28495.pep
MGRNFLRLPSVSGRSSFVYSIVACSNLPKRRSIVLSFGHIMTENMTLEQL
SANKCFEGEQRVYRHRSDTLKCDMTFGVFLPPAALEGKPCPVLFFLSGLT
CTHENFIQKSGFQQHAARHNLIVVNPDTSPRGVEIAGQDDAYDFGSGAGF
YVDAKEEPWSKHYKMYSYVTQELVDVVNANLPVVPGKRGIFGHSMGGHGA
LICALKNPGLYQSVSAFAPIANPTECPWGKKAFAGYLGSNPDDWALWDAT
HLVSQYESTPQELFIDQGAADNFLAGKQLLPENLLAAADGNDHIQTIFKQ
REGYDHSYFYIATFVAEHIAYHAALLTASAASFLDH

BO28495.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-PB 330 CG4390-PB 1..330 1..330 1763 100 Plus
CG4390-PA 286 CG4390-PA 1..286 45..330 1541 100 Plus