Clone BO28501 Report

Search the DGRC for BO28501

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG2023-RA
Protein status:BO28501.pep: Imported from assembly
Sequenced Size:715

Clone Sequence Records

BO28501.complete Sequence

715 bp assembled on 2011-07-13

GenBank Submission: KX799025

> BO28501.complete
GAAGTTATCAGTCGACATGGACAAGGATGCGTTTACATTACAGGCCATAC
GGCAGGACCTTATCGATAACAATCTGCAGGCTAAGGCAATAATACACGAC
ATCCTGAACAGCCGCACCTCCATCGCCGAACTCGAGGAGCTGAACGAAGC
GGGCCGCTCCAAACTGTCTGCTATCCGCAAAAGCATCGAGCGGCTGGACG
ACTGGGCGCGGGACACGGCAGACTCTGCGCTGGCCAATGAAGTGGACGAC
CACCGTGATCAGTTCTCCAAAACGCTGCAGGCGTTCCGAAAAGCAAACGT
GTCCACGATGCTGGAGATCGAGAAGGCCAATCGGGAGGAGTTAATGGCCA
TTACCGGCGAGAGTGAGCTACGCCAACGAACCACAACACGGGCGCGGCAC
AACCAGGGCAGTCTGGTTTCGCAGGAGAACGACGTGACCGAGAAGATGCT
GGCTATATCGCGGCACCTCTCGGAGACCACCCAGAAGAGCGCCATCACCC
TGGAAACGCTCGTGGCCTCGTCGCAAAATGTGGAGGCCACCAGCGACGAA
CTGCACCACACGGCCGGCAGCATTAGCATGTCCGGCAAGCTGCTCAAAAA
GTACGGACGACGCGAGTGCACTGACAAAATGCTGCTCTTCTTCGCCTTCT
CCTTGTTCCTCGCCTGTGTCTTTTACATCGTCCAAAAGCGACTCTTCGCA
AGCTTTCTAGACCAT

BO28501.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023-RA 684 CG2023-PA 1..681 17..697 3405 100 Plus
CG2023-RB 684 CG2023-PB 1..681 17..697 3405 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023-RA 2426 CG2023-RA 61..744 14..697 3420 100 Plus
CG2023-RB 953 CG2023-RB 89..772 14..697 3420 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5823708..5824307 697..98 3000 100 Minus
3R 32079331 3R 5824360..5824444 98..14 425 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:48:23 has no hits.

BO28501.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:06 Download gff for BO28501.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 64..744 17..699 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:07 Download gff for BO28501.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RA 64..744 17..699 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:27:51 Download gff for BO28501.complete
Subject Subject Range Query Range Percent Splice Strand
CG2023-RB 92..772 17..699 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:27:51 Download gff for BO28501.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5824361..5824441 17..97 100   Minus
3R 5823706..5824307 98..699 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:07 Download gff for BO28501.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1650083..1650163 17..97 100   Minus
arm_3R 1649428..1650029 98..699 99 <- Minus

BO28501.pep Sequence

Translation from 16 to 715

> BO28501.pep
MDKDAFTLQAIRQDLIDNNLQAKAIIHDILNSRTSIAELEELNEAGRSKL
SAIRKSIERLDDWARDTADSALANEVDDHRDQFSKTLQAFRKANVSTMLE
IEKANREELMAITGESELRQRTTTRARHNQGSLVSQENDVTEKMLAISRH
LSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRE
CTDKMLLFFAFSLFLACVFYIVQKRLFASFLDH

BO28501.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG2023-PA 227 CG2023-PA 1..227 1..227 1119 100 Plus
CG2023-PB 227 CG2023-PB 1..227 1..227 1119 100 Plus