Clone BO28508 Report

Search the DGRC for BO28508

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG31220-RB
Protein status:BO28508.pep: Imported from assembly
Sequenced Size:1123

Clone Sequence Records

BO28508.complete Sequence

1123 bp assembled on 2011-07-13

GenBank Submission: KX795197

> BO28508.complete
GAAGTTATCAGTCGACATGTGTGCACGCAAGCGGACGGAGGGCAATCTTT
GCCGTCGCCATAAAAGTGGCTGCAGTGCAAACCAATATAAACTGTGTGAA
CCGGATGAGGAGTGCATCCGACTTAAGGATTGCCGACCCATATATTACAA
TGTGAGGAGAAACAGATTGTCGGGGTCCGCAAAAGTGAATATATCGCAGA
CAAGAATGTGTGGCGTGAGTGTTCGAGACCGGAAACGTTACAAAAGGATT
TATATCTGCTGTCCCAAGCCGGCAAACACCTTGCCAAGCTATCCGGATTG
TGGGAAGCCACAAACGACTAACCGTGTTATAGGCGGCACGGAGCCGAATC
TCAACGAATATCCGTGGCTGGCCATGCTTCTATATCGAAATCGTAGTGCC
TTCAACCCGGATCGGGAGCTAGTCCCCAGTTGTGGTGGCTCCCTGATTAA
CACTCGCTATGTCCTGACCGCAGCCCACTGTGTAACCGATACGGTCTTGC
AAATCCAACGCGTCCGCCTGGGCGAGCACACAACGTCCCATAACCCGGAC
TGCATCAGCCGGGGCGCACGAATCGTTTGCGCTCCCACACATCTGGACAT
CGACGTGGAGTCGATCACATCGCATAATGACTACGATCCAGCCAATTACA
CCTTTCGGAACGACATCGCCCTGGTGCGACTCAAAGAGCCAGTGCGATAT
ACGATGGCTTACTATCCGATTTGCGTTCTGGACTACCCAAGGTCACTGAT
GAAATTCAAGATGTACGTGGCTGGATGGGGAAAAACGGGCATGTTCGACA
CTGGGAGCAAGGTGCTGAAACACGCTGCCGTCAAGGTAAGGAAACCAGAA
GAGTGCTCGGAAAAGTACGCACACCGGCATTTCGGGCCCAGATTCCAGAT
ATGCGCCGGCGGCTTGGATAACCGGGGCACCTGCGACGGCGACTCCGGCA
GTCCATTGATGGGCACATCGGGTCGCAGCTACGAGACAATCACGTTCCTG
GCCGGCATCACTTCATACGGAGGTCCTTGCGGCACGATTGGCTGGCCGAG
TGTTTTCACACGAACGGCGAAGTTTTACAAATGGATACGGGCACACTTAA
GGCCCGCAAGCTTTCTAGACCAT

BO28508.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG31220-RB 1092 CG31220-PB 1..1089 17..1105 5445 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG31220-RB 1421 CG31220-RB 276..1364 17..1105 5445 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19649448..19650057 87..696 3050 100 Plus
3R 32079331 3R 19650120..19650529 696..1105 2050 100 Plus
3R 32079331 3R 19648841..19648910 17..86 350 100 Plus
Blast to na_te.dros performed 2014-11-26 16:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 3309..3374 27..89 187 80.3 Plus

BO28508.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 12:52:51 Download gff for BO28508.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 213..1301 17..1107 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:14:53 Download gff for BO28508.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 213..1301 17..1107 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:32:25 Download gff for BO28508.complete
Subject Subject Range Query Range Percent Splice Strand
CG31220-RB 276..1364 17..1107 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:32:25 Download gff for BO28508.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19650121..19650529 697..1107 99   Plus
3R 19649448..19650057 87..696 100 -> Plus
3R 19648841..19648910 17..86 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:14:53 Download gff for BO28508.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15475843..15476251 697..1107 99   Plus
arm_3R 15475170..15475779 87..696 100 -> Plus
arm_3R 15474563..15474632 17..86 100 -> Plus

BO28508.pep Sequence

Translation from 16 to 1123

> BO28508.pep
MCARKRTEGNLCRRHKSGCSANQYKLCEPDEECIRLKDCRPIYYNVRRNR
LSGSAKVNISQTRMCGVSVRDRKRYKRIYICCPKPANTLPSYPDCGKPQT
TNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVL
TAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESI
TSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY
VAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGL
DNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRT
AKFYKWIRAHLRPASFLDH

BO28508.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31220-PB 363 CG31220-PB 1..363 1..363 1995 100 Plus
CG16710-PB 372 CG16710-PB 25..362 22..357 619 42 Plus
CG10232-PD 509 CG10232-PD 180..509 19..363 604 41 Plus
CG31219-PB 345 CG31219-PB 25..345 27..363 577 40.6 Plus
CG18754-PB 341 CG18754-PB 30..341 27..363 565 39.1 Plus