Clone BO28511 Report

Search the DGRC for BO28511

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptmRpL28-RA
Protein status:BO28511.pep: Imported from assembly
Sequenced Size:940

Clone Sequence Records

BO28511.complete Sequence

940 bp assembled on 2011-09-14

GenBank Submission: KX796720

> BO28511.complete
GAAGTTATCAGTCGACATGGCACACGCCACGCCACAGGGCGTAAAGCTAT
TAAACGGATGGAAGCGTCCGGGTCGCTTTGACAAGGGTCTGGGAGCCCAG
CTGCCCGAGGCGTACAGGAAGTTCTGGCGCGAGTGGAAGCTGACGACCCC
GGCTGCGGTCCATTATATCCCCAAGGAGCAGCAGTGGGAACGAGATGAGG
TGACGCACGCCATCAAGCCGGTGCAGAACATCCCGCTGCCATTGATCGAT
ACGCCGGAATCGCACCGTGGCATCTGGGGTGGCGAGGCCGTGATCAAGGG
CTTTCAGAAACGCGAGCAAACAAAGCGTCGCGTGCCGCACTTTTGGGTAC
CAAATCTTAGGCGTTCGGTGGTCCATAGTCATGTGCTGGACTGCTACATG
TCCGTGGTGGTGACGGAACGCACGCTGGAGCAGATCCATGAATGTCATGG
CTTTGATCACTACCTCCTCAAGAATCGTGCCTGCGATCTTCGCTCCGCTT
TGGCTCTGAAACTCAAGCGAGAGGTGCTTCAGGCCCTGCAGAACGGTGTT
CCAGCCCTCGCCGACGAGCCCGAACGCCAACAGGAAGTGCTTAAGGAATA
CCGCCGCTATCTGGAACCATATACGCCCGAGGAAATCGATTGGTACGGCC
ATACCTATTTGGAGGCCATACGCAAGCTGCAAAAGCAGCTGCGCGAAGCG
GAAAAAGTGGTGCCGCATAAGTTGGAGTTCCGCGGAAAGCTTATCGAGCA
GCTGCGCCAGGCGGGGATCAGCGAAGCGGGAAAGCTGGAGAAGCCGGATG
CATTAGCAGCAGAATCGTCGGTCGAACACAAGGATTCGGATATCGAAGCG
CTTACAAAGCTGGAATCCTCCCCCTCTTCCAGTTGGCTGTCTAAAATCAA
TCCTTTCGGCAAGAAAGAAACCGCAAGCTTTCTAGACCAT

BO28511.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL28-RB 909 CG3782-PB 1..906 17..922 4515 99.9 Plus
mRpL28-RA 909 CG3782-PA 1..906 17..922 4515 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL28-RB 1170 CG3782-RB 162..1067 17..922 4515 99.9 Plus
mRpL28-RA 1138 CG3782-RA 162..1067 17..922 4515 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4974274..4975101 35..862 4125 99.9 Plus
2L 23513712 2L 4975153..4975213 862..922 305 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:14:50 has no hits.

BO28511.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:17 Download gff for BO28511.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 160..1065 17..924 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:52 Download gff for BO28511.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 162..1067 17..924 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:06:33 Download gff for BO28511.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL28-RA 162..1067 17..924 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:06:33 Download gff for BO28511.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4975153..4975213 862..924 96   Plus
2L 4974277..4975100 38..861 99 -> Plus
2L 4974137..4974157 17..37 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:52 Download gff for BO28511.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4975153..4975213 862..924 96   Plus
arm_2L 4974277..4975100 38..861 99 -> Plus
arm_2L 4974137..4974157 17..37 100 -> Plus

BO28511.pep Sequence

Translation from 16 to 940

> BO28511.pep
MAHATPQGVKLLNGWKRPGRFDKGLGAQLPEAYRKFWREWKLTTPAAVHY
IPKEQQWERDEVTHAIKPVQNIPLPLIDTPESHRGIWGGEAVIKGFQKRE
QTKRRVPHFWVPNLRRSVVHSHVLDCYMSVVVTERTLEQIHECHGFDHYL
LKNRACDLRSALALKLKREVLQALQNGVPALADEPERQQEVLKEYRRYLE
PYTPEEIDWYGHTYLEAIRKLQKQLREAEKVVPHKLEFRGKLIEQLRQAG
ISEAGKLEKPDALAAESSVEHKDSDIEALTKLESSPSSSWLSKINPFGKK
ETASFLDH

BO28511.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL28-PB 302 CG3782-PB 1..302 1..302 1604 100 Plus
mRpL28-PA 302 CG3782-PA 1..302 1..302 1604 100 Plus