Clone BO28512 Report

Search the DGRC for BO28512

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptAcp95EF-RA
Protein status:BO28512.pep: Imported from assembly
Sequenced Size:190

Clone Sequence Records

BO28512.complete Sequence

190 bp assembled on 2011-07-13

GenBank Submission: KX793900

> BO28512.complete
GAAGTTATCAGTCGACATGGCCTCAGTAAAATTGTTCTTTATTGCTATTT
TGGTTGTAGCTCTATCCCTTAACACCTCAGCTGCAGTGTTGAACCCTAGT
TCGACTGCCAAACCCAGATTTGAGACGAAAGACCGAAAACTAAGTGCTGG
CGCTCTGCAGTCACTCGCTGGTGCAAGCTTTCTAGACCAT

BO28512.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-RA 159 CG17924-PA 1..156 17..172 780 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-RA 243 CG17924-RA 16..173 15..172 790 100 Plus
Spase22-23-RB 1694 CG5677-RB 827..965 172..34 695 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24229071..24229209 34..172 695 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:47:40 has no hits.

BO28512.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:06 Download gff for BO28512.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 18..173 17..174 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:50 Download gff for BO28512.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 18..173 17..174 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:27:37 Download gff for BO28512.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 18..173 17..174 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:27:37 Download gff for BO28512.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24229072..24229209 35..174 98   Plus
3R 24228992..24229009 17..34 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:50 Download gff for BO28512.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20054794..20054931 35..174 98   Plus
arm_3R 20054714..20054731 17..34 100 -> Plus

BO28512.pep Sequence

Translation from 16 to 190

> BO28512.pep
MASVKLFFIAILVVALSLNTSAAVLNPSSTAKPRFETKDRKLSAGALQSL
AGASFLDH

BO28512.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-PA 52 CG17924-PA 1..52 1..52 242 100 Plus