Clone BO28517 Report

Search the DGRC for BO28517

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG1317-RB
Protein status:BO28517.pep: Imported from assembly
Sequenced Size:2998

Clone Sequence Records

BO28517.complete Sequence

2998 bp assembled on 2011-08-04

GenBank Submission: KX794826

> BO28517.complete
GAAGTTATCAGTCGACATGGACGACCTGTCGCAGGGCGACATTTGCCGCG
TGTGCAGATGCGAGGCACAGCCGGATAGGCCTCTTTTCTACCCGTGCATC
TGCACTGGATCGATCAAGTACATTCATCAGGACTGCCTGATGTTATGGAT
GCGCTACTCGCACAAGGAATACTGCGAGCTGTGCAGCTACAGCTTCAGCT
TTCAGCCCATCTATGCTCCGGATATGCCGCGAGTCCTGCCGATAAAGGAT
GTCCTTGTGGGACTGATGTCCGCCGTTTTGGAGGGCGCTCGCTGCTGGCT
TCATTACACCCTGGTCGGTTTGGCCTGGTTCGGAGTGGTGCCGCTGTCTG
CCTACAGGACCTATCGGTACCTCTTCCGGGCGAGCTCCTTCGATATGATT
CTCACGCTGCCCTTTGACATCTTCTCCGTTGAAAACCTGGCATCGGATGC
CTTTCGGGGCTGTTTTGTGGTCACATGCACACTTTTGTCCTTCATAGGAT
TGGTCTGGCTGCGCGAGCAGATCCTGCATGGCGGCGGACCCGATTGGCTG
GAGCGGGACGATGCCCCTCTACAGGCAGCGGCTGCTAATCCTGCGCCTGA
TCCCGCCGCCGAGGCAGCTCCACAGCCTCAGGACGACAACAACAATGCCG
ACGACAATGAAGCGCCGGCTCCAGCGGACAACGATGGGCAGGATGCCCAG
GCCCAGGATGCCGCACCAGCGGCTGCAGCTCCCGTCGTGGACGCCGATGC
CGATGAGCAGAATTGGAATCCCATGGAGTGGGATCGGGCTGCCGAGGAGC
TTACCTGGGAACGCCTGCTCGGACTCGATGGCTCGCTAGTTTTTCTGGAG
CACGTCTTCTGGATCATCTCACTGAACACCATGTTCATCTTCACCTTCGC
CTTTTGTCCCTACTGCGTGGGCAACTTCATTCTGAGCTCCATGGATCTTT
TGCAGCCCGAGAAACCACTGCTACACTTTCACGGCCTGATTACCACGCTA
TTTGGTTACTGCTGCATTGGATTGACCCTGGTGGTGCTGCACTTCTTCTC
CAGAGTTTTCCGCCTGCGGAGAGTCTGCTGGTTCATTGGATTGTGCTATA
TTGTGGTCAAGGTGTCGCTGCTGTCGGTGTTGGAGATCGGAGTACTCCCG
CTGATTTGCGGCTGGTGGCTGGACATTTGTTCGTTGCCCCTACTAGATGC
CAGCCTCAAGGATCGTAAAGAGAGTTTTAAGGCTGCTCCGGGCACCTCAC
TTTTTGTCCACTGGATGTTTGGCATGGTATACGTTTACTACTTCGCTGCG
TTTGTATCGTTGTTGCGCGAGGTGCTGCGACCGGGAGTGCTCTGGATATT
CCGCAATGTCAACGATCCTGACTTCAGTCCCATCCAGGAAATGATCCATG
TACCAATTGTGAGACACATCCGGCGGCTGGTCGCTTCGGCTATGATCTTT
GGATTTGCAGTGCTCTTGATGCTCTGGCTGCCCATTAGAATTCTGCAGGT
GGTTTGTCCGGACTTCTTGCCATATGCACTTAGTGGCGATTCAGCGGTTA
ACTTGCAATTGCTGCTCTTACAAATCGTTTTGCCGGGCTTCTTCGAGCAG
ACCCAAACACGCATCTGGCTAAAGGGCTTGCTGCGCATTTGGTGCACAGC
GGTGGCCTGGTTGCTGGGCATACGAAGCTACCTGCTCCCAGCACCGGAGC
CGGAACCGGAAATTCCCGCTGCTGGAGAAGAAGGCGTGGAGAATGCCGCT
GGCGAAAATGAAAACCAGGAAGGTGAGGCAGCGGATGCGGCAGCCCAACC
ACCAGCACCACCTCCTCCACCGCCACCGCCAGTGGAACCGGCGCCGGCAC
CACGAAACCTTGCCGCCGCCCATCAGGCCATCATGCAACGGGATGCACCC
GTGGGATTCCAGCCGTACGACAAGCCATCGCTGTTCGCTTTACGTTTGTG
TGCCCTGTTGGCACTCATGTGTTTGTCCATCGTTTGTGCTGCCATGTTGA
CGCTCACGGTTCCAGTCTACATCGGTCGGCGGCTGATGTTGATCTGGTCC
TCCCAGCCGGATGAGAAGGCAGCTGGAGCGGCAGCCGCAGAAGGAGCGGG
CGAAGTGGTTGAAAATCTAGATCCAATCGATCCGGAAGGAGCCAGAAAGA
ACGAGCGACTACTGCGCTCGCATGAGCTGTACACCGCTGAGCTTGGTGGT
TACCTGTGCTGGATTGTCTGCCGGGTAGTAGCTGCGGTGGTCACCCTGCT
GCCACAAGGCCGCGCGGCTATTGTCGACAAGATAAAGCACTGGGTCCGAG
TGGCATTGCAATATGCCCTGCCCGTTCTAACACTCCTGGGAATCTTCGTG
CTGGTTCCGTTGCTGATTGGATTGCTGATCGAGTTGGCGGTGGTCATTCC
CCTACGCGTTCCACTACGCAAGACACCAATCCACTTCCTATGGGAGGATT
GGGCGCTGGGAGTGCTCTACTGCAAGATAGCCATCGCCTTGACGATGATG
GGCCCAGATTGGCACTTGAAGCGTGCATTAGATCGAGCCTACATGGATGG
ATTGCGCGATTTCGACTTGAAGTTTGTGATGCGAGACTTGGCTGTGCCGG
TCGTTACTACCATTGGTCTGGCCCTGGCCATACCCTATGTCATGGCACAT
ATGATGTTTCCGATTTTCCTAGCGGACGCCTATGCTCAGCATGTCGTCGC
ACGGCTCGTGTATCCCGTAAGCTTCATTGTGGTGGGCAGCATATGCATCC
TTTTGTTCCAGATCGATCAGCTGAAGAAGCTCTATCTGTCCATCAAGGTG
GATAAGTACCTGGTGGGTCAGAGGCTGGTCAACTATGAGCACCGCAAGAA
GCAGCAACAGCAGCAGGAGGAGGAGAAGGAGCAACAGCGGGCGGCCCGGG
AATTAAGGGAGAACCAGGAGAGAGATCGGGAGCGAGAGCGGGAACAGTTG
GTCCAGGAGCTCGAGTTGGCTGAACTTCTGGCAAGCTTTCTAGACCAT

BO28517.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-RD 2967 CG1317-PD 1..2964 17..2980 14820 100 Plus
CG1317-RC 2967 CG1317-PC 1..2964 17..2980 14820 100 Plus
CG1317-RB 2967 CG1317-PB 1..2964 17..2980 14820 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-RD 3836 CG1317-RD 278..3241 17..2980 14820 100 Plus
CG1317-RC 3665 CG1317-RC 278..3241 17..2980 14820 100 Plus
CG1317-RB 3869 CG1317-RB 278..3241 17..2980 14820 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2370106..2371662 1573..17 7785 100 Minus
3L 28110227 3L 2368642..2370048 2980..1574 7035 100 Minus
Blast to na_te.dros performed 2014-11-27 00:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6853 2838..2947 147 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6840 2832..2946 139 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6789..6839 2838..2888 138 74.5 Plus
roo 9092 roo DM_ROO 9092bp 1068..1141 2847..2920 136 64.9 Plus
roo 9092 roo DM_ROO 9092bp 1067..1133 2819..2888 135 70 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2290..2364 2813..2888 134 65.8 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 865..1010 2740..2890 132 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2397 2830..2888 130 71.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6768..6818 2838..2888 129 72.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2319..2378 2830..2890 122 68.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6834..6877 2847..2890 121 75 Plus
roo 9092 roo DM_ROO 9092bp 1095..1145 2838..2888 120 70.6 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 633..723 2934..2848 120 63.7 Minus

BO28517.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:50 Download gff for BO28517.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RC 299..3262 17..2982 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:38:10 Download gff for BO28517.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RB 278..3241 17..2982 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:13:17 Download gff for BO28517.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RB 278..3241 17..2982 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:13:17 Download gff for BO28517.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2370106..2371662 17..1573 100   Minus
3L 2368640..2370048 1574..2982 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:38:10 Download gff for BO28517.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2370106..2371662 17..1573 100   Minus
arm_3L 2368640..2370048 1574..2982 99 <- Minus

BO28517.pep Sequence

Translation from 16 to 2998

> BO28517.pep
MDDLSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHK
EYCELCSYSFSFQPIYAPDMPRVLPIKDVLVGLMSAVLEGARCWLHYTLV
GLAWFGVVPLSAYRTYRYLFRASSFDMILTLPFDIFSVENLASDAFRGCF
VVTCTLLSFIGLVWLREQILHGGGPDWLERDDAPLQAAAANPAPDPAAEA
APQPQDDNNNADDNEAPAPADNDGQDAQAQDAAPAAAAPVVDADADEQNW
NPMEWDRAAEELTWERLLGLDGSLVFLEHVFWIISLNTMFIFTFAFCPYC
VGNFILSSMDLLQPEKPLLHFHGLITTLFGYCCIGLTLVVLHFFSRVFRL
RRVCWFIGLCYIVVKVSLLSVLEIGVLPLICGWWLDICSLPLLDASLKDR
KESFKAAPGTSLFVHWMFGMVYVYYFAAFVSLLREVLRPGVLWIFRNVND
PDFSPIQEMIHVPIVRHIRRLVASAMIFGFAVLLMLWLPIRILQVVCPDF
LPYALSGDSAVNLQLLLLQIVLPGFFEQTQTRIWLKGLLRIWCTAVAWLL
GIRSYLLPAPEPEPEIPAAGEEGVENAAGENENQEGEAADAAAQPPAPPP
PPPPPVEPAPAPRNLAAAHQAIMQRDAPVGFQPYDKPSLFALRLCALLAL
MCLSIVCAAMLTLTVPVYIGRRLMLIWSSQPDEKAAGAAAAEGAGEVVEN
LDPIDPEGARKNERLLRSHELYTAELGGYLCWIVCRVVAAVVTLLPQGRA
AIVDKIKHWVRVALQYALPVLTLLGIFVLVPLLIGLLIELAVVIPLRVPL
RKTPIHFLWEDWALGVLYCKIAIALTMMGPDWHLKRALDRAYMDGLRDFD
LKFVMRDLAVPVVTTIGLALAIPYVMAHMMFPIFLADAYAQHVVARLVYP
VSFIVVGSICILLFQIDQLKKLYLSIKVDKYLVGQRLVNYEHRKKQQQQQ
EEEKEQQRAARELRENQERDREREREQLVQELELAELLASFLDH

BO28517.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-PD 988 CG1317-PD 1..988 1..988 5212 100 Plus
CG1317-PC 988 CG1317-PC 1..988 1..988 5212 100 Plus
CG1317-PB 988 CG1317-PB 1..988 1..988 5212 100 Plus
CG4080-PB 617 CG4080-PB 38..93 5..60 194 51.8 Plus
CG4080-PA 617 CG4080-PA 38..93 5..60 194 51.8 Plus