Clone BO28520 Report

Search the DGRC for BO28520

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCG34408-RA
Protein status:BO28520.pep: Imported from assembly
Sequenced Size:4628

Clone Sequence Records

BO28520.complete Sequence

4628 bp assembled on 2011-08-23

> BO28520.complete
GAAGTTATCAGTCGACATGTACTCCGAGTGGGCCTCGCTGTCTGCCCAAA
TCACAGCCAACAGCTGCGGCGCCCAGTGCTTCAGTGTGCTCAACAAATTC
CCCGCCTCCGCCGGACGCGAAGTGGTCGTCTCCGTGGTCAAGCAGCTGGG
CACCAATCTGGGCATCACGCAGAATGCAGAGCCCAGTCACCTGGTCAAAG
ACGAAGAGGTAAAATGGTGCATGGACGTGATCTGCTTCGGACTTTCGCTT
CCTCTGCAGGAACACGAGACGATCAAGGATTGCGTGAATGTGTACTGCGA
GTGGCTGACGGCGCTGCATCCGCAGCCCAGGATCAGTGTACCGAAGCCGA
TATGCGAGGATGCCAATCTCTATGCTCGCCAGATCATCAATCACTTTCAC
AATCTGTTTGTGCCGCGCCAGGGCGAAAGTGCAGATACAATTAAACGGCA
GGCAGTGCTCTGCCATCGGGTGCTACGAACTCTGCAGCAAACTGCTCAGA
TATCGCAGCTAATGGATCGGCAGACGTGGGACACGCTGCTTCTCTTTCTG
CTGGCTATCAATGAGATCCTGCTGGCGCCGCCCACCGTCAAGGACGATGT
GGGCGATCAGCTGTGCGAGCGTGTGCTATCCGTGCTCTTCGAGGTCTGGC
TTCTGGCCTGCGTTCGCAGTTTTCCCTCACCGTCGATGTGGAAGACGCTG
CAGGAGTCGTGTGCCATGTGGCGACACCGTGTAGCCCTCGTGGATCAATG
GAATCGAGTGAACTTGGCACTAACCGCTCGCCTGCTGGAGTTCAGCTATG
GTCCTGCGTTTCCACAGCTCAAGAATGCCGACGAGGATGGCCAGCTGATA
CCAATTGGAATGTCCAACGACTGTGTGGCCCAGACTTGGTACCGCTTCCT
GCGTATGATTGGCAATCCCACGGCGCTCTGTTCACCACATATCATCAGCA
AATCATCACACTTTGTTCAGTGGGCGTTGACCCATGAAAAGGGCGCCGAG
ACGCATCAGCATCCCTGCCTGCAACAACTGCCGCAGATCTTCCTCAATGC
CATGAAGGGAATTTCCAGTCAAGTGGACGCTTTTCTAGGCTTGAGCAAGA
CCTCGCTTATTGGCCTCACCGGCGGTGGTGCACGCAACGCGATCAGCAGC
AGCAGCACCACCACCACCAATGCCGGCAGCACGGGAGGAACGGGATCGGG
AGATGGATCCGCTCCTGCTCCGCTGCCCACAACTCCCACGTCCACGTCGG
GTCCGCCGTCGGCGAGTAGCAGCATCAACTCTCTGCCGTTGACTTCGATG
GGAGCGGGTGTCGAGCTGGCCGTGGCCAGACCCAAATGCAACAGCATTCT
CCACGTATTCCACGAGTGGCTCTTCGAGGCGGCGCACATCGGAGGCGACA
CTTGGCGGCAAAATCGTAAAAAGCAAGCATGCGAGGCCAGTAAACGGCCA
TCGTCGATGATAATGGAGCACCGCAAGGGATCGATATCGTTGTCGCAGCC
CAACTCTCTGAACGATCCGCAATCGTTGCCACCCACGCTGACCATCGACA
AGTATGAGTCCGGCCGAGCCGAGGCCATTGGAACGCTGTGCAAGATCTTC
TGTGCAAAGAAGACGGGCGAGGAGATTCTGCCCGTCTATCTGGCCCGCTT
CTACATGGCATTGCAGCAGTGCCTGAAGATTACAGAGTCGCGGGAATGCG
ACGAGACGTTGGCCAGCATCCTGCTGCATTCGAGTGACCTGTTTCGCCTG
GACCTGGATGGGATTAATGTGCTGCTGCCCGGTTTCATTGCCGCCTTGGA
AATCGTACTGCCCGACAAGGACCTCAAGCTGAAGACGCAATCGATGGTCT
TTAATCGCACCGAATTGCGCCGTTCGGCGATTAACATCCTGCTGTCCATC
ATGGTGCTGCCGTTGCACTACCAAACGCTGCCCATTCGGGATTTGACCTG
CGAATCGAGCGAGAAAATGTTTACCTTCATCCAACTGAAGTCGCGGCTCA
TGAACATCTTGATGAATGCCCTGCAGGTCGAGACGGATGCCCAAAACACG
CACATGCTTCTGGGCGGCCTGCTGCTCTGCGTTCAGGATGCCGTCACCTT
CGAGGAGACGGAACTGGGCGGCGGCAATGCCAATCTCTCGCAGAACTCGA
GTGGTGTGCAGCATCATGACGCCAATCTACTGAGTTCGGCGTGCTCGGAG
CGTTCCGCTTCGCTGGTCAGCGCTGGCACAGCCAGCTTGGGCGGTCAGAC
GACGGCCACCATGGGAGCGGGATCGGGCTCCATTCGCGACACCGCCTCCG
CCCACGACTACCCCAGTCTGACCATATCCGATGACATGTCATTCGAGTTC
GGCCAGGAACTGGAAGGGGTGACCACCTATGATAATGCCCATGCTCTATT
TGTGCGCGCCACGTATTTGGTCTGCCATCGTCTGATCTCGTCGTGGAAGA
CGGATCTGAATGTTTCGCTGGCCGCCTTGGAGTTGCTGTCCGGCTTGGCC
AGGTTACATATCCGGGAAACAGACGCTCTAGAGTGCAAGCGGGCCGTGAA
GTGGATCTGTGACTATATATGCTACCAGTGCTCCCGTCCGCCGCCGGCGC
ATAGCAAGGATCTGCACAGCACCATTGTGGCGGCCTTTCAGTGCACCGCC
GCCTGGCTGATGCAGCATCCCTATTTGCTGCAGGACAAGGATTGCCTGCA
AACGGTCCTCGAGGTGGTTGAGCTGGGCATTTCGGGCACCAAGAGCCAGA
GCAAGGGCACCGATATACCCAAATTTAAGGACGAAAAGGAGCTAAAGCCC
GCCTCGATGAGAGTGCGAGATGCTGCTGAGAATCTGCTGACAATTATCCT
CGAGCAAGTGGGCTATTTCCCCAGCGAATGCGGTCCAGAGTCCATATCCT
CGCTATTGGATGAGCTGGCGCTCATGAAGCACTGCAACTCTATGGTGCCG
GCGGCGGCGGCCAGCAGTGAGCAGGCCATTGCCAAGTTTAAGTACTTTGT
GACCGAGAACTCCACCATATTGGCACTGCTCGAGGAGCCGTTGGGCAATG
ACCAGGATCCCCAACCCACAGTGACTCTGCTCATACGCGGTCCCTTTGGT
CGACATGCCTGGACCATGCAGTTGCGTCATCTGCCTCGCAGTAAGTCTGG
GATTAAGTACCATGCCATTAATCCTGGCAGGCCCATACCCATGAACGATG
TGACGCAACGGCTGGATAGCGAGCAAAAGAACTTTCCCGACGGCGTGGAC
AAAGTGCAACCGTGTGTGGCGGACTACTCTATACCCACCATCGAACAAAT
GCGCGAGCAATACGGCACTGCTGTCATACGGGAGCTGGAGTCGTTGCTGG
AGAACCAGAGCATTCACGAGAAACTGGCCTGGGCGGAGGCGGACACCAGT
GCGGATAGTTTGTCGCATGCCCAAGAATGTGTGCCGCCAACGGTGTGCCA
CGAGTTCCATGCGGCGCGTCTATTTCTCTCACATTTTGGTTTTCTGGGAT
TCGAGACGCGGAATCCACAGAATCCAGCTGAGGCACTGGGCAATCCGCCA
CAGCGACCGCTAATCGTGCTGGACACCAAGTCCGCAGCCTTCGCCGCCGA
TCTGGATCGTTTGGACAAGCTGAGTGCGAGGACGCACGACAGCGTTTATG
TGTTCTATGTGAAGAGTGGCCAAACGAGTGCCCAGCAGATTATCGCCAAT
ATGGGCGAGGAATCGTCTGCCAGCCATGATCCGCACTTCGCTAGCATGCT
GCAAACGCTGGGCTGGCCGGTTCAGGTTTCAGAACACTCTGGCTGGACGG
GCTTTGCCCACAACTCGTGGTCACTCAAGGGAACGCCCGAGGAGCAGCTA
AAGTCCACTGCCAACGAGCTGAACTATAATGGATCACAGAGGGTGCTCTA
CTGGGCGGATGTGTCATCGGAAATCGCCTTCGTGGTGCCCACGACATGGA
ATCTGCGTTACAATAGCGACACTTGCGATAGTGGAAGTATCTCGAGCACG
GATCAGATTGGCTCCAGCAATGTCTGGACACGCGGAGAGGCCGATAGTGC
GGCTGGCCTGGCAAAATCCAAGTCAAGGAATCTTAGCCTAGAACTCGACA
CGAATCGCAGGGATGTAAAGGAGCCAGTTCCGCCGACGCGACGAAAAGGA
AATGTGACGAAACCCACACTATTGGCCCAGGCGCCGGCCAAAATCTTTTT
GGTGTGGCTGGAGAGCTATGAGGATTACCTAAACTTTCCGCTCGAGGATC
TGCTAGCCTATACACGCACTGGCGAGGAGCTGCAGACGCAACAGTTGCCT
CGCGCCTCCGACTGTCACGTGATCTTCGTGCATTCGTTGCTCTCGGGACT
TCTGAGAGTAAAGTTGCAGGGTCCACCGGGAAGGATGAGCTTTGCCACGC
CCCTGGTCGATGGCATGGTCCTGAGCCGGCGGGTAGTCGGAAATCTGGTT
CGACAAACGGCATTGAACATATCACGCCGCCGGCGTCTGGACAATGATAA
CTACCAACCGCCTCATGTGCGACGACGACTCAAGGTGCAGGACATTGTCC
AGAAGTACAAAATGGATCTGAGCGAGGCCGATCTGTTGGCCCATCTGTTC
CAACGCGCAATTGCAAGCTTTCTAGACC

BO28520.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-RA 4599 CG34408-PA 1..4596 17..4612 22980 100 Plus
CG34408-RH 5187 CG34408-PH 1660..5184 1088..4612 17625 100 Plus
CG34408-RB 5157 CG34408-PB 1630..5154 1088..4612 17625 100 Plus
CG34408-RH 5187 CG34408-PH 443..1104 429..1090 3310 100 Plus
CG34408-RH 5187 CG34408-PH 1..412 17..428 2060 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-RA 5236 CG34408-RA 440..5035 17..4612 22980 100 Plus
CG34408-RH 5824 CG34408-RH 2099..5623 1088..4612 17625 100 Plus
CG34408-RB 5794 CG34408-RB 2069..5593 1088..4612 17625 100 Plus
CG34408-RH 5824 CG34408-RH 882..1543 429..1090 3310 100 Plus
CG34408-RH 5824 CG34408-RH 440..851 17..428 2060 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10228663..10229507 3656..4500 4195 99.8 Plus
X 23542271 X 10228023..10228609 3078..3664 2935 100 Plus
X 23542271 X 10227400..10227957 2520..3077 2790 100 Plus
X 23542271 X 10225191..10225734 1422..1965 2720 100 Plus
X 23542271 X 10221866..10222264 429..827 1995 100 Plus
X 23542271 X 10222325..10222587 827..1089 1315 100 Plus
X 23542271 X 10221361..10221584 207..430 1120 100 Plus
X 23542271 X 10225798..10226021 1966..2189 1120 100 Plus
X 23542271 X 10220549..10220742 17..210 970 100 Plus
X 23542271 X 10224312..10224505 1087..1280 970 100 Plus
X 23542271 X 10226179..10226375 2189..2385 970 99.5 Plus
X 23542271 X 10226514..10226655 2381..2522 710 100 Plus
X 23542271 X 10224919..10225059 1281..1421 705 100 Plus
X 23542271 X 10229583..10229694 4501..4612 560 100 Plus
Blast to na_te.dros performed 2014-11-27 01:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2490..2535 1135..1180 140 78.3 Plus
TART-C 11124 TART-C TARTC 11124bp 9170..9230 1135..1194 140 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6763..6870 1134..1238 126 61.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6835..6882 1134..1181 123 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2442 1135..1180 122 73.9 Plus

BO28520.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 09:34:40 Download gff for BO28520.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 440..5035 17..4612 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:59 Download gff for BO28520.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 440..5035 17..4612 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:31:48 Download gff for BO28520.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 440..5035 17..4612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:31:48 Download gff for BO28520.complete
Subject Subject Range Query Range Percent Splice Strand
X 10229583..10229694 4501..4612 100   Plus
X 10228672..10229507 3665..4500 100 -> Plus
X 10228023..10228609 3078..3664 100 -> Plus
X 10227403..10227957 2523..3077 100 -> Plus
X 10226515..10226655 2382..2522 100 -> Plus
X 10226180..10226371 2190..2381 100 -> Plus
X 10225798..10226021 1966..2189 100 -> Plus
X 10225191..10225734 1422..1965 100 -> Plus
X 10224919..10225059 1281..1421 100 -> Plus
X 10224314..10224505 1089..1280 100 -> Plus
X 10222326..10222586 828..1088 100 -> Plus
X 10221866..10222264 429..827 100 -> Plus
X 10221363..10221582 209..428 100 -> Plus
X 10220549..10220740 17..208 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:59 Download gff for BO28520.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10123616..10123727 4501..4612 100   Plus
arm_X 10122705..10123540 3665..4500 100 -> Plus
arm_X 10122056..10122642 3078..3664 100 -> Plus
arm_X 10121436..10121990 2523..3077 100 -> Plus
arm_X 10120548..10120688 2382..2522 100 -> Plus
arm_X 10120213..10120404 2190..2381 100 -> Plus
arm_X 10119831..10120054 1966..2189 100 -> Plus
arm_X 10119224..10119767 1422..1965 100 -> Plus
arm_X 10118952..10119092 1281..1421 100 -> Plus
arm_X 10118347..10118538 1089..1280 100 -> Plus
arm_X 10116359..10116619 828..1088 100 -> Plus
arm_X 10115899..10116297 429..827 100 -> Plus
arm_X 10115396..10115615 209..428 100 -> Plus
arm_X 10114582..10114773 17..208 100 -> Plus

BO28520.pep Sequence

Translation from 16 to 4627

> BO28520.pep
MYSEWASLSAQITANSCGAQCFSVLNKFPASAGREVVVSVVKQLGTNLGI
TQNAEPSHLVKDEEVKWCMDVICFGLSLPLQEHETIKDCVNVYCEWLTAL
HPQPRISVPKPICEDANLYARQIINHFHNLFVPRQGESADTIKRQAVLCH
RVLRTLQQTAQISQLMDRQTWDTLLLFLLAINEILLAPPTVKDDVGDQLC
ERVLSVLFEVWLLACVRSFPSPSMWKTLQESCAMWRHRVALVDQWNRVNL
ALTARLLEFSYGPAFPQLKNADEDGQLIPIGMSNDCVAQTWYRFLRMIGN
PTALCSPHIISKSSHFVQWALTHEKGAETHQHPCLQQLPQIFLNAMKGIS
SQVDAFLGLSKTSLIGLTGGGARNAISSSSTTTTNAGSTGGTGSGDGSAP
APLPTTPTSTSGPPSASSSINSLPLTSMGAGVELAVARPKCNSILHVFHE
WLFEAAHIGGDTWRQNRKKQACEASKRPSSMIMEHRKGSISLSQPNSLND
PQSLPPTLTIDKYESGRAEAIGTLCKIFCAKKTGEEILPVYLARFYMALQ
QCLKITESRECDETLASILLHSSDLFRLDLDGINVLLPGFIAALEIVLPD
KDLKLKTQSMVFNRTELRRSAINILLSIMVLPLHYQTLPIRDLTCESSEK
MFTFIQLKSRLMNILMNALQVETDAQNTHMLLGGLLLCVQDAVTFEETEL
GGGNANLSQNSSGVQHHDANLLSSACSERSASLVSAGTASLGGQTTATMG
AGSGSIRDTASAHDYPSLTISDDMSFEFGQELEGVTTYDNAHALFVRATY
LVCHRLISSWKTDLNVSLAALELLSGLARLHIRETDALECKRAVKWICDY
ICYQCSRPPPAHSKDLHSTIVAAFQCTAAWLMQHPYLLQDKDCLQTVLEV
VELGISGTKSQSKGTDIPKFKDEKELKPASMRVRDAAENLLTIILEQVGY
FPSECGPESISSLLDELALMKHCNSMVPAAAASSEQAIAKFKYFVTENST
ILALLEEPLGNDQDPQPTVTLLIRGPFGRHAWTMQLRHLPRSKSGIKYHA
INPGRPIPMNDVTQRLDSEQKNFPDGVDKVQPCVADYSIPTIEQMREQYG
TAVIRELESLLENQSIHEKLAWAEADTSADSLSHAQECVPPTVCHEFHAA
RLFLSHFGFLGFETRNPQNPAEALGNPPQRPLIVLDTKSAAFAADLDRLD
KLSARTHDSVYVFYVKSGQTSAQQIIANMGEESSASHDPHFASMLQTLGW
PVQVSEHSGWTGFAHNSWSLKGTPEEQLKSTANELNYNGSQRVLYWADVS
SEIAFVVPTTWNLRYNSDTCDSGSISSTDQIGSSNVWTRGEADSAAGLAK
SKSRNLSLELDTNRRDVKEPVPPTRRKGNVTKPTLLAQAPAKIFLVWLES
YEDYLNFPLEDLLAYTRTGEELQTQQLPRASDCHVIFVHSLLSGLLRVKL
QGPPGRMSFATPLVDGMVLSRRVVGNLVRQTALNISRRRRLDNDNYQPPH
VRRRLKVQDIVQKYKMDLSEADLLAHLFQRAIASFLD

BO28520.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-PA 1532 CG34408-PA 1..1532 1..1532 7967 100 Plus
CG34408-PD 1468 CG34408-PD 1..1468 1..1532 7512 95.2 Plus
CG34408-PH 1728 CG34408-PH 554..1728 358..1532 6067 100 Plus
CG34408-PB 1718 CG34408-PB 544..1718 358..1532 6067 100 Plus
CG34408-PE 1724 CG34408-PE 544..1724 358..1532 6050 99.5 Plus
CG34408-PB 1718 CG34408-PB 1..359 1..359 1907 99.7 Plus
CG34408-PH 1728 CG34408-PH 1..369 1..359 1882 96.7 Plus