Clone BO28522 Report

Search the DGRC for BO28522

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptCG3308-RA
Protein status:BO28522.pep: Imported from assembly
Sequenced Size:991

Clone Sequence Records

BO28522.complete Sequence

991 bp assembled on 2011-07-13

GenBank Submission: KX795851

> BO28522.complete
GAAGTTATCAGTCGACATGGACCCCAGTCAACAGACGCCCCAGGAGACGG
TGGTGGCCCCCGTGGCCCCGCTGCTGGAGGATCAGCTGGAATTGGACATG
AAGCACTGCTTTGAGAACCTGATCGTCATCGACGTGGGTGCGAATCTGAC
CAACAAGAAGTATAGCCGTGATCTGGATTCCGTGGTGCAGAGAGCCAGAG
ACGCAGGTGTCCAGAAACTAATGGTTCACGGCACTTCGGTCAAATCGAGC
AAGGAAGCGCTGCGCCTTTCGCGCATCTATCCCGACATAATCTACTCAAC
TGCTGGCATTCACCCGCACGACTCCAAGTCCATCGTGGAAGAGCCGGCCA
CGTGGTTCGATCTGGAGCACATCGCCCAGGCGCAGGAGTGTGTGGCGATT
GGCCCCTGCGGCTTGGACTACCAGCGGGACTTCTCCGAACCGGACGCCCA
GAAGCAGATCTTCGCCAAGCAGCTGCATCTGGCCATCCGGCTAAATAAAC
CTCTGCTGATCCACGAGCGGTCGGCTCAGCTCGATTTACTCGAAATACTA
GACAAATTCGAGAATCTTCCGCCTGTGATCATCAGAGGTTTTATGGGCAC
CGCCGAGGAGGCGCTTAAGTACCTAGACCGGAGGTTCTACATCAGCCTGA
CGGGCTACCTGTGCAAGGACAAATCGGATACTGGCGTTCGCCGCCTGCTG
GAGGACGGCACATTGCCGCTAGACAGACTACTGGTGGAGACGGATGCTCC
TTTCATGTACCCAAACACAAGGGCTTCCAAGCTACCGCAACACGTGAAGA
CTGGTATCACCGAACGCTCATTGTTGTACTTACACAGATATTGTACCTTC
CAACGCAACGAGCCGTGCAGTTTGCCCGCCATTGTAGAGATGATAGCCGC
CTTCATGAAGAAAAGCCCGGACGAGGTGGCTTTGGCCACTGCCTTTAATG
CCCTGAAACTGTTTGGGTTGTCCGCAAGCTTTCTAGACCAT

BO28522.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-RA 960 CG3308-PA 1..957 17..973 4770 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-RA 2124 CG3308-RA 286..1244 15..973 4780 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21272487..21272839 555..203 1765 100 Minus
3R 32079331 3R 21272155..21272436 837..556 1410 100 Minus
3R 32079331 3R 21273339..21273532 208..15 970 100 Minus
3R 32079331 3R 21271958..21272096 973..835 680 99.3 Minus
Blast to na_te.dros performed on 2014-11-26 16:48:40 has no hits.

BO28522.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:07 Download gff for BO28522.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 286..1242 17..975 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:18 Download gff for BO28522.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 288..1244 17..975 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:27:56 Download gff for BO28522.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 288..1244 17..975 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:27:56 Download gff for BO28522.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21273341..21273530 17..206 100   Minus
3R 21272487..21272835 207..555 100 <- Minus
3R 21272155..21272436 556..837 100 <- Minus
3R 21271956..21272093 838..975 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:18 Download gff for BO28522.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17099063..17099252 17..206 100   Minus
arm_3R 17098209..17098557 207..555 100 <- Minus
arm_3R 17097877..17098158 556..837 100 <- Minus
arm_3R 17097678..17097815 838..975 97 <- Minus

BO28522.pep Sequence

Translation from 16 to 991

> BO28522.pep
MDPSQQTPQETVVAPVAPLLEDQLELDMKHCFENLIVIDVGANLTNKKYS
RDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDIIYSTAGIHP
HDSKSIVEEPATWFDLEHIAQAQECVAIGPCGLDYQRDFSEPDAQKQIFA
KQLHLAIRLNKPLLIHERSAQLDLLEILDKFENLPPVIIRGFMGTAEEAL
KYLDRRFYISLTGYLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFMYPN
TRASKLPQHVKTGITERSLLYLHRYCTFQRNEPCSLPAIVEMIAAFMKKS
PDEVALATAFNALKLFGLSASFLDH

BO28522.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-PA 319 CG3308-PA 1..319 1..319 1642 100 Plus
CG3358-PG 291 CG3358-PG 10..283 47..316 272 31.4 Plus
CG3358-PF 291 CG3358-PF 10..283 47..316 272 31.4 Plus
CG3358-PE 291 CG3358-PE 10..283 47..316 272 31.4 Plus