Clone BO28523 Report

Search the DGRC for BO28523

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG9855-RA
Protein status:BO28523.pep: Imported from assembly
Sequenced Size:1180

Clone Sequence Records

BO28523.complete Sequence

1180 bp assembled on 2011-07-13

GenBank Submission: KX799157

> BO28523.complete
GAAGTTATCAGTCGACATGGCCGACAAAGCTGCAGCGCCCTCTGTGGACT
GTGCGGCGCCATCTGTGGACTGTGCGACGCCTGCAATACCAGCCGTGGAG
GATCACACCACGCTGACCGTTCCACCTGCTTCAGCGAACAAAGCCACGGA
CGCTTCCACTTCCACTGCCGTCCAAGTGGCCGTCGATGGGGGGGAGCCGG
AACGCTGCTGCTGGATCTGCTTCGCCACCGATGAGGACAACCGTCTGGCG
GCGTGGGTGAAGCCCTGTCAGTGCCGCGGCACCACCAAGTGGGTGCACCA
GAGCTGCCTCTACCGCTGGATCGATGAAAAAACCCAGAAGGGTAACGCTC
TACGCACTGTATCGTGTCCGCAGTGCCAAACGGAGTACATCATAGTGTTC
CCGCAGATGGGCAAGCTTGGAGGTGCTTTAGAGGCAATAGATAACCTCAT
CAAGCGCCTGAGCCCCTTCCTGGCGGCTGGTTTCTTCGTGGGCTCCCTCT
ACTGGACAGCAGTAACTTACGGAGCAGTCACATTTTTACAGATTGTCGGA
CATGAGCACGGCATGTCCATAATGGAGTCTGGAGATCCGCTCGTTCTCCT
TATTGGGTTGCCGGCTATTCCAGTGGGGCTTGTGCTTGGTCGATTGATTC
GCTGGGAGGATGCATTGTTGCGTCTTATTCGAAACCGCGGGACGGTGGTG
CGGAAGTTTCCTTTTGTAAGCCTTATTTATCCGAACCTCAGCCAGGAAGA
GGAACAGCAAAGCATCAGCAATCCGGCCACACCGGCTCTCTCTGACCCTG
TCTCAGCCACGAGGGTCTTCTGCGGCGCTCTCTTGCTGCCCACCATATCG
TCGATCGTGGGACGTATTCTCTTTGACACGGTTGATAACACATTGCATCG
TACTCTGCTTGGAGGTCTGACCTTTATAACGGTCAAGGGAATTCTGAAAA
TTTATTTGAAGCAGAAACAGTACGGCCGCCGCAAGAAGCGCCGAATTGTG
GACTACACTGAGGAAAATATTCGGAACTTCATGCACCGCAACAATAACTC
GGCAGCAGCGGCGCGGCAGGAAAGGCTGCCCGAGCAGAGGCCAGTGCCAC
CAGCGGAGCGAAGGGACGCTGTAATCACACGTCAACGCGGCGATAGTGGT
GGTAGCGTTGTCGCAAGCTTTCTAGACCAT

BO28523.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855-RC 1149 CG9855-PC 1..1146 17..1162 5730 100 Plus
CG9855-RA 1149 CG9855-PA 1..1146 17..1162 5730 100 Plus
CG17991-RA 885 CG17991-PA 57..251 199..393 210 73.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855-RC 1718 CG9855-RC 169..1318 13..1162 5735 99.9 Plus
CG9855-RA 1533 CG9855-RA 169..1318 13..1162 5735 99.9 Plus
CG17991-RA 1064 CG17991-RA 122..316 199..393 210 73.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4397112..4397640 541..13 2630 99.8 Minus
3R 32079331 3R 4396379..4396802 1162..739 2120 100 Minus
3R 32079331 3R 4396860..4397058 738..540 995 100 Minus
3R 32079331 3R 27241388..27241582 199..393 210 73.8 Plus
Blast to na_te.dros performed on 2014-11-26 16:59:23 has no hits.

BO28523.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 12:52:52 Download gff for BO28523.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 185..1330 17..1164 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:15:01 Download gff for BO28523.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 173..1318 17..1164 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:32:30 Download gff for BO28523.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 173..1318 17..1164 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:32:30 Download gff for BO28523.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4397112..4397636 17..541 100   Minus
3R 4396860..4397056 542..738 100 <- Minus
3R 4396377..4396802 739..1164 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:15:01 Download gff for BO28523.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 222834..223358 17..541 100   Minus
arm_3R 222582..222778 542..738 100 <- Minus
arm_3R 222099..222524 739..1164 99 <- Minus

BO28523.pep Sequence

Translation from 16 to 1180

> BO28523.pep
MADKAAAPSVDCAAPSVDCATPAIPAVEDHTTLTVPPASANKATDASTST
AVQVAVDGGEPERCCWICFATDEDNRLAAWVKPCQCRGTTKWVHQSCLYR
WIDEKTQKGNALRTVSCPQCQTEYIIVFPQMGKLGGALEAIDNLIKRLSP
FLAAGFFVGSLYWTAVTYGAVTFLQIVGHEHGMSIMESGDPLVLLIGLPA
IPVGLVLGRLIRWEDALLRLIRNRGTVVRKFPFVSLIYPNLSQEEEQQSI
SNPATPALSDPVSATRVFCGALLLPTISSIVGRILFDTVDNTLHRTLLGG
LTFITVKGILKIYLKQKQYGRRKKRRIVDYTEENIRNFMHRNNNSAAAAR
QERLPEQRPVPPAERRDAVITRQRGDSGGSVVASFLDH

BO28523.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855-PC 382 CG9855-PC 1..382 1..382 1992 100 Plus
CG9855-PA 382 CG9855-PA 1..382 1..382 1992 100 Plus
CG16781-PA 383 CG16781-PA 32..337 56..345 735 47 Plus
CG16781-PB 386 CG16781-PB 35..340 56..345 735 47 Plus
CG17991-PA 294 CG17991-PA 2..288 46..335 715 52.4 Plus