Clone BO28524 Report

Search the DGRC for BO28524

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCG12582-RA
Protein status:BO28524.pep: Imported from assembly
Sequenced Size:2758

Clone Sequence Records

BO28524.complete Sequence

2758 bp assembled on 2011-08-05

GenBank Submission: KX798872

> BO28524.complete
GAAGTTATCAGTCGACATGAAGTACGGATGCGGATTACTCAGGAATGGCA
CCACGGGCGCTGTTATGGTCGGATTAGTTTGTGGCCTTTATGTTTGCAGC
GGCCAATGTGATAAGGTGGAAGTAATAGAGCTGAGCAATTGGACGATAAC
TAATCAGAATGGCTCCCTGACTATTGCCAACCAAACGTTGCCCTTGGGCA
TATACAGTGCCTTCGCACCCCAAGTGCTGGACTCCTACAACGACGTCGGT
CTGCGTTACTTGGCCTACGACAACTTTACCTTCTCCAATTTCTTTCAGTT
CGACGTTCATCACTTCAATCGCGGCCACATCAACCTGACGTTTCACGGCA
TTGACACGGTGTCGGAAATCCGGCTGAACCATCAACTGCTGGGACGCACG
GACAACATGTTTGTCCGCTACTCTTACGAAGTGAGTTCCCTGCTCCAAGC
GGAAAACTTTCTGGAAGTTGAGATCCAATCTCCAGTTGTGGCTGCTTTGG
CAAGAGCCAATGCTTTAAAAGAAGCTAAAAAGAGCGTGCCTCCCGAATGC
CCCAACGAGCGCTACCATGGTGAGTGCCACATGAACATGCTGCGGAAGAT
GCAGGCTAGCTTTTCCTGGGACTGGGGTCCTGCAGCTCCCTCTGCTGGAA
TCTGGAAAAACGTGGAGCTGGAAATCTACGAGGTGGCGGTTATTCGTGAG
GTGGATGTGGACGTTAGCCGCGTCAATGGTTCGTACTGGAACATGCATAT
TCGCTGCTTCCTGGACGCGGGAGGCTGGCAAAACTTCAATGGAAGACTCG
TCCTATATGCTGTCGAGCTATTGGACCGTCCGGTAGTAGTAGACAGATAC
GCAATAAAAAACATCAGTCACTTGGCGCCAGTAATTGAATTCGATCAGGC
CGTGCCAAATGGGAAAGTCGTAACCTGGTGGCCCAATGGCTACGGCGAGC
AGAAACTGTATCCGCTCCACTTCACTCTGAAGACCTGGCTGGGACCTGAT
GGACCCGAGGTTCGCTCTAAGACCAAGTCGCACAAGTCGCTCCGAGTGGG
TTTTCGTACGCTTGATCTAGTAGAGGATCCCGCCCCTGACGGCGTTGGAA
ACACCTTCCTGTTTCGAGTTAATGGTGTAGAAATGTTTATGAAAGGCAGT
AACTACATACCATCCCACTTATTACCCGAAATGCAAACAAATGAACAGAT
TTCACATTTATTAAGGTCCGCCAAGGAAGCCCATATGAACATGCTTCGAG
TCTGGGGAGGCGGAGTTTACGAATCGGACTACTTTTACCAGCTCGCCGAC
AGCTTGGGTCTTCTAATTTGGCAAGATATGATGTTTGCTTGTGCCATGTA
CCCGGTTAACGACGAATTCCTATCGTCAGTGCGTGAGGAGGTTCGCCAGA
ATGCCATGCGACTATCACACCATCCAAGCGTAGCCATTTTTGTGACCAAT
AACGAAAACGAAGCTGCTTTGGTACAGAACTGGTACGGCACGCTTTTCGA
AAGAGATCGATTTGAGAGCGAGTACCGGGAGCTCTACCTTGCTAATGTCA
TCCACGAGTTGAAGCTTGTTTCGCATAGCTCTCGACCTCAGCCACTGGTC
TCCTCACCTTCAAATGGCAAAGCTAGTGAACCGGACAACTATATTTCGAG
CAACCCTCAGGATAACCAAAATGGCGATGTACATTTCTACGACTACACTA
AGGACGGCTGGGATCCAGGAATTTTCCCACGTCCTCGATTCGTCAGTGAG
TTCGGCTTTCAGAGCTTTCCAGGCGCATACGCATGGCAGCGCAGCAAGGG
CGAGGACGATGACCTCCTCGGCCTGATCACACACCGACAACACCACCCAC
TGGGAAATGTTCCTGTTATCGCACTAGTGGAGAGACACCTACCGCTGCCC
TTTCCAGAGAATGAGAACTACGCGACAGCACTGATTTACTTCAGCCAGAT
TGCTCAAGCCATGGCCACAAAGGTGGAAACCGAATTATACCGTAGCCTTC
GGGACACTCCCCACAGAACGATGGGGGCCCTTTACTGGCAGCTGAATGAT
GTATGGGTGGCGCCATCCTGGTCCAGCATTGATTTCTACGGCAACTGGAA
GCTGCTCCATTACTGGGCACGTGATTTTCTAGCGCCTATTTCAATCGTTG
CTCTTTACGAAAAGTCCACGGATTCGTTAAACATCTCCCTTATTTGTGAC
CAATTGGAGGTGGACCCAAGGGAACTGAATGTCGTAGCTAACGTTCACCT
GTGGTCCCAGCTTCTGCCTCGGCAGTCCACCTCCTGGGATGTTACCCTGC
GCCCCAATGGCGTGCAGTACGACAAGGTCATTGCCATCTCCGATCTGCTG
CAAGGAGAGTTCACCAGAACTAACGCGTTTTTGGAGCTGCAGTTGCGCCG
CGGGCAGGATGTGATCTCTAGGACCCACTTCTTTCCCAGTAGCATTGCCG
GAGCAGTCGGAATAGAGGACCCCGGGCTTGAGTTCGAGATTGCCTCCCGT
ACCTGTCTTAACACCACAAACGTCGTCCGCAACAGCGTCAGCATTAGCAT
ACAGGTGAAGCGCCCCGCCGTATTTGTATACCTAGAGCTGCTCAAGCCAT
ACCGCTACACCCTGTCCGAGAACGGATTTATGCAGACTGAGCCAATGCAT
GTCGTCTACCTAACGTTCGACGCACCCTTGTGCGCCCGCCTTTTGCGCAA
GTCGGACCTCCGTGTGCTGACCGTCAACGACTTTATGAGAGCAAGCTTTC
TAGACCAT

BO28524.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-RD 2727 CG12582-PD 1..2724 17..2740 13620 100 Plus
CG12582-RA 2727 CG12582-PA 1..2724 17..2740 13620 100 Plus
CG12582-RH 2721 CG12582-PH 1..2718 17..2740 13495 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-RD 2922 CG12582-RD 96..2820 16..2740 13625 100 Plus
CG12582-RA 3035 CG12582-RA 210..2933 17..2740 13620 100 Plus
CG12582-RH 3029 CG12582-RH 210..2927 17..2740 13495 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4198259..4198772 300..813 2570 100 Plus
3R 32079331 3R 4201843..4202322 1200..1679 2400 100 Plus
3R 32079331 3R 4202375..4202797 1679..2101 2115 100 Plus
3R 32079331 3R 4203780..4204162 2100..2482 1915 100 Plus
3R 32079331 3R 4199005..4199293 911..1199 1445 100 Plus
3R 32079331 3R 4204211..4204470 2481..2740 1300 100 Plus
3R 32079331 3R 4197415..4197562 17..164 740 100 Plus
3R 32079331 3R 4197737..4197871 165..299 675 100 Plus
3R 32079331 3R 4198830..4198927 814..911 490 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:35:55 has no hits.

BO28524.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-05 11:49:11 Download gff for BO28524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 109..2832 17..2742 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:45 Download gff for BO28524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RD 97..2820 17..2742 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:28:37 Download gff for BO28524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RD 97..2820 17..2742 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:28:37 Download gff for BO28524.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4204213..4204470 2483..2742 99   Plus
3R 4203782..4204162 2102..2482 100 -> Plus
3R 4202376..4202797 1680..2101 100 -> Plus
3R 4201843..4202322 1200..1679 100 -> Plus
3R 4199005..4199293 911..1199 100 -> Plus
3R 4198830..4198926 814..910 100 -> Plus
3R 4198259..4198772 300..813 100 -> Plus
3R 4197737..4197871 165..299 100 -> Plus
3R 4197415..4197562 17..164 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:45 Download gff for BO28524.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 29935..30192 2483..2742 99   Plus
arm_3R 29504..29884 2102..2482 100 -> Plus
arm_3R 28098..28519 1680..2101 100 -> Plus
arm_3R 27565..28044 1200..1679 100 -> Plus
arm_3R 24727..25015 911..1199 100 -> Plus
arm_3R 24552..24648 814..910 100 -> Plus
arm_3R 23981..24494 300..813 100 -> Plus
arm_3R 23459..23593 165..299 100 -> Plus
arm_3R 23137..23284 17..164 100 -> Plus

BO28524.pep Sequence

Translation from 16 to 2758

> BO28524.pep
MKYGCGLLRNGTTGAVMVGLVCGLYVCSGQCDKVEVIELSNWTITNQNGS
LTIANQTLPLGIYSAFAPQVLDSYNDVGLRYLAYDNFTFSNFFQFDVHHF
NRGHINLTFHGIDTVSEIRLNHQLLGRTDNMFVRYSYEVSSLLQAENFLE
VEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMNMLRKMQASFS
WDWGPAAPSAGIWKNVELEIYEVAVIREVDVDVSRVNGSYWNMHIRCFLD
AGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNISHLAPVIEFDQAVPNGK
VVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLD
LVEDPAPDGVGNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQISHLLR
SAKEAHMNMLRVWGGGVYESDYFYQLADSLGLLIWQDMMFACAMYPVNDE
FLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWYGTLFERDRFE
SEYRELYLANVIHELKLVSHSSRPQPLVSSPSNGKASEPDNYISSNPQDN
QNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQRSKGEDDDL
LGLITHRQHHPLGNVPVIALVERHLPLPFPENENYATALIYFSQIAQAMA
TKVETELYRSLRDTPHRTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYW
ARDFLAPISIVALYEKSTDSLNISLICDQLEVDPRELNVVANVHLWSQLL
PRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTNAFLELQLRRGQDVI
SRTHFFPSSIAGAVGIEDPGLEFEIASRTCLNTTNVVRNSVSISIQVKRP
AVFVYLELLKPYRYTLSENGFMQTEPMHVVYLTFDAPLCARLLRKSDLRV
LTVNDFMRASFLDH

BO28524.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-PD 908 CG12582-PD 1..908 1..908 4833 100 Plus
CG12582-PA 908 CG12582-PA 1..908 1..908 4833 100 Plus
CG12582-PH 906 CG12582-PH 1..906 1..908 4809 99.8 Plus
CG12582-PG 778 CG12582-PG 1..778 131..908 4134 100 Plus
CG12582-PF 778 CG12582-PF 1..778 131..908 4134 100 Plus