Clone BO28525 Report

Search the DGRC for BO28525

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptUgt-RA
Protein status:BO28525.pep: Imported from assembly
Sequenced Size:4678

Clone Sequence Records

BO28525.complete Sequence

4678 bp assembled on 2011-07-28

GenBank Submission: KX795789

> BO28525.complete
GAAGTTATCAGTCGACATGTTACGTGCCGTGGCTTTGTGTGTGTCTGTGG
TGCTCATAGCACTATATACGCCAACTTCTGGGGAATCCAGTCAGAGCTAT
CCCATCACCACGCTAATCAACGCGAAATGGACGCAGACGCCCCTATATCT
GGAAATCGCCGAGTATCTGGCCGATGAGCAGGCGGGCCTCTTCTGGGATT
ACGTTTCGGGGGTGACCAAGTTGGACACGGTTCTCAACGAATATGATACC
GAGTCGCAACAGTACAATGCCGCCTTGGAGCTGGTCAAGAGCCATGTGAG
TTCTCCCCAATTGCCCCTGCTTAGGCTGGTGGTATCCATGCATAGCTTGA
CGCCCCGGATCCAGACCCACTTCCAGTTGGCCGAGGAACTGAGGAGCAGT
GGCTCTTGTCAGAGCTTTACTTTTGCCCAGGTGGGTTCCGAACTGGCCTG
CAGCTTTAACGAGCTGCAGAAGAAGCTGGAAGTGCCGCTCGCCAAGGATA
GCTTGGATGCTTCTGTTGTCACCTACAGCTTTGATCACATTTTCCCTGGC
AGTGAGAACAATACCCGCACTGTGGTACTATACGGCGATTTGGGAAGCTC
TCAATTCCGCACCTATCACAAACTATTGGAAAAGGAAGCCAATGCTGGCC
GGATTCGTTACATCTTGCGTCATCAATTGGCCAAGAAGGACAAGCGACCG
GTACGACTTTCGGGCTATGGAGTGGAACTCCATCTGAAGTCAACGGAATA
CAAGAGTCAGGATGATGCTCCAAAGCCCGAAGCTGGTTCCACTTCTGATG
AGGATTTGGCTAATGAATCGGACGTCCAGGGCTTTGATTTCAAGGTGCTG
AAGCAGAAGCATCCTACACTTAAGAGAGCGCTGGATCAACTGCGTCAGAG
GCTTCTTCAGGGAAACGATGAGATCGCCCAATTGAAAGCATGGGAGTTCC
AGGATTTGGGTCTCCAGGCGGCCGCTGCTATTGCAGAAATACAGGGTGAT
GAAACCCTACAAATTCTTCAATATACTGCCCATAATTTCCCCATGTTGGC
CAGAACCCTGCTGGCCCACAAGGTTACGGATGGCTTAAGGGCGGAGGTAA
AGCATAATACGGAAGCATTTGGAAGAAGCTTGAATGTAGCGCCTCCAGAT
GGTGCCCTTTTCATCAATGGACTCTTCTTCGATGCTGACACAATGGATCT
GTATTCCCTGATTGAGACGCTGCGCTCGGAGATGCGTGTTCTCGAGAGTC
TGCACAGTAATAATGTGAGGGGAAGCCTTGCCAGCTCCTTGCTCGCCTTG
GATCTGACGGCCTCCAGCAAAAAAGAATTCGCCATCGACATCCGTGACAC
TGCAGTACAGTGGGTCAACGATATTGAAAACGATGTGCAGTACCGCAGGT
GGCCCTCATCGGTGATGGATCTTTTGCGTCCAACCTTTCCTGGCATGTTA
AGGAATATCCGAAAGAATGTGTTCAATTTGGTCCTAGTGGTAGACGCGCT
GCAGCCCACAGCTAGAAGTGTTATTAAACTGTCAGAGTCGTTTGTCATCC
ATCAAGCTCCCATTCGCTTGGGTTTGGTTTTCGATGCGAGGGACGCCAAC
GAGGATAATCTTGCAGATTACGTAGCCATCACGTGCGCCTATAACTATGT
GAGTCAGAAAAAGGATGCCCGAGCTGCTTTAAGTTTCCTCACCGACATCT
ACGCAGCAGTTGGTGAGACCAAAGTGGTCACGAAAAAAGACATAGTCAAG
CAACTAACGAAGGAATTTACATCATTAAGCTTTGCCAAAGCGGAGGAGTT
CCTGGAGGAAGATTCCACGTACGACTATGGCAGGGAGCTCGCAGCAGAGT
TCATTCAGCGGCTGGGATTCGGAGACAAGGGACAACCTCAGGCCTTGTTG
AATGGTGTTCCAATGCCCAGCAACGTTGTGACCGCCGATAGCGACTTCGA
GGAGGCTATTTTCACCGAGATTATGACCCACACCAGCAATCTCCAAAAGG
CTGTGTACAAAGGTGAACTGACAGACAACGATGTAGCCATTGATTATCTG
ATGAATCAACCTCACGTGATGCCCAGATTGAATCAGCGAATCCTAAGCCA
GGAGGATGTGAAATATCTTGATATTAACGGCGTGGCCTACAAAAATCTTG
GCAATGTTGGAGTTTTAAATCGTCTGTCTAACCGGGATATGACCGCTACG
CTAATGGATAATCTTAAATACTTTGGTGGCAAGAAGTCTACGGAGCTTAT
TGGCCGAGCATCCCTACAGTTCCTAACGATTTGGGTGTTTGCTGATTTGG
AAACTGACCAGGGTCGAGATCTGCTCACCCATGCCCTGGACTATGTCCAA
AGTGGAGAGAGTGTGCGAGTCGCATTCATTCCAAACACTGAAAGCTCTTC
CGCCTCAAGCCGGAGGAATCTTAATCGATTGGTTTGGGCTGCCATGCAGA
GTCTTCCACCAACTCAAGCCACGGAGCAGGTTCTCAAGTGGCTAAAGAAA
CCAAAGGAGAAAATTGAGATACCCACTCAGCTCGAGGATATCCTGGGATC
TACAGAGCTGCACCTGAAGATGTTGAGAGTTTATTCCCAGCGAGTGTTGG
GTCTAAATAAATCCCAGCGTTTGGTCATCGGTAATGGGCGGCTTTATGGG
CCCCTTTCGTCGGATGAAAGCTTTGATAGCGCCGATTTCGCTTTGCTAGC
CAGGTTCAGTTCTCTACAGTATAGCGATAAGGTGCGTCAGGTCCTGAAGG
AATCTGCTCAAGATGTCAATGAGGAATTCAACAGCGATACATTGCTTAAG
TTGTATGCCAGCCTGCTTCCCAGGCAAACCAAAACTCGCTTTAAGCTACC
AACGGACTTAAAAACCGATCACTCGGTTGTAAAACTACCGCCCAAACAGG
AGAATCTTCCCCATTTTGATGTTGCCGCCGTTTTGGATCCCGCCTCCCGA
GCAGCTCAAAAACTAACGCCAATACTTATTTTGCTTCGTCAAGTGCTGAA
CTGCCAATTGAACTTATACCTGATTCCCGTCCCCCAGCACAGCGATATGC
CCGTGAAGAACTTCTACAGATACGTTGTGGAACCGGAGGTCCAATTCGAG
GCGAATGGAGGCCGATCTGATGGTCCTTTGGCCAAATTCAGTGGATTGCC
AGCCAATCCTCTGCTGACCCAGCAGCTGCAGGTTCCCGAGAACTGGTTGG
TCGAAGCTGTGAGAGCAGTTTACGATCTGGACAACATTAAGTTGACCGAT
ATTGGTGGACCTGTGCACAGCGAATTCGATCTGGAGTATCTGCTGTTGGA
GGGTCACTGCTTTGATGCTGCTAGCGGCGCTCCGCCCAGAGGACTTCAGT
TGGTGTTGGGTACCCAGAGTCAACCTACCTTGGTAGATACTATTGTGATG
GCGAATTTGGGTTATTTCCAACTTAAAGCCAATCCAGGAGCTTGGTCCCT
ACGCTTGCGTGAAGGCAAATCGGCGGATATTTATGCAATCAGCCACATTG
AAGGAACAAATACCCATCATTCGGCTGGCTCTTCTGAAGTTCAGGTTCTT
ATAACCTCCTTGCGATCCCATGTTGTCAAATTAAGGGTGTCTAAGAAGCC
AGGCATGCAGCAGGCGGAACTCCTGTCAGATGACAACGAACAGGCAGCGC
AATCAGGCATGTGGAACAGCATCGCCAGCAGTTTTGGCGGCGGCAGTGCC
AACCAAGCAGCCACTGATGAGGATACGGAAACCATCAACATTTTCTCTGT
GGCATCGGGACACTTGTACGAACGTCTTCTAAGGATCATGATGGTTTCGC
TGCTAAAGCACACAAAATCACCTGTGAAGTTCTGGTTCTTGAAGAACTAT
CTTTCGCCGCAATTTACGGATTTCCTTCCTCACATGGCCAGTGAGTACAA
CTTCCAGTACGAATTGGTCCAGTACAAATGGCCCCGCTGGCTGCATCAGC
AAACGGAAAAACAGAGGACCATTTGGGGCTACAAGATCCTTTTCCTGGAC
GTGCTCTTCCCGCTGAATGTGAGGAAAATCATTTTCGTGGATGCCGATGC
CATCGTAAGAACGGATATAAAGGAGTTGTATGACATGGACCTCGGAGGAG
CACCCTATGCCTACACGCCATTCTGCGATTCCCGCAAAGAGATGGAGGGC
TTCCGATTCTGGAAGCAGGGATACTGGCGAAGCCATCTGATGGGCAGGCG
TTACCACATTTCCGCCTTGTACGTGGTGGACTTGAAGAGATTCCGCAAGA
TTGCGGCAGGAGATAGGCTAAGAGGCCAATACCAGGCACTTAGCCAGGAT
CCGAACAGCTTATCCAATTTGGATCAGGACTTGCCCAACAACATGATCCA
CCAGGTCGCCATCAAATCCCTGCCCGACGACTGGCTATGGTGCCAAACGT
GGTGCAGCGACAGCAACTTCAAGACTGCTAAAGTGATTGATTTGTGCAAC
AACCCGCAGACCAAGGAGGCCAAACTCACGGCCGCCCAGAGGATTGTGCC
CGAATGGAAGGACTACGATGCCGAGCTGAAGACCCTGATGTCTCGCATCG
AGGATCATGAGAATTCGCATAGCAGGGACTCGGCAGTTGATGATTCGGTT
GACGATTCGGTGGAGGTCACCACTGTGACGCCTTCTCATGAGCCCAAGCA
CGGCGAGCTGGCAAGCTTTCTAGACCAT

BO28525.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-RA 4647 CG6850-PA 1..4644 17..4660 23220 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-RA 5316 CG6850-RA 203..4847 16..4660 23225 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18873361..18877776 245..4660 22080 100 Plus
3L 28110227 3L 18872949..18873178 16..245 1150 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:19:34 has no hits.

BO28525.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-28 13:15:06 Download gff for BO28525.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 209..4847 22..4662 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:54:23 Download gff for BO28525.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 209..4847 22..4662 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:57:42 Download gff for BO28525.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 209..4847 22..4662 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:57:42 Download gff for BO28525.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18873362..18877776 246..4662 99   Plus
3L 18872955..18873178 22..245 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:54:23 Download gff for BO28525.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18866462..18870876 246..4662 99   Plus
arm_3L 18866055..18866278 22..245 100 -> Plus

BO28525.pep Sequence

Translation from 16 to 4678

> BO28525.pep
MLRAVALCVSVVLIALYTPTSGESSQSYPITTLINAKWTQTPLYLEIAEY
LADEQAGLFWDYVSGVTKLDTVLNEYDTESQQYNAALELVKSHVSSPQLP
LLRLVVSMHSLTPRIQTHFQLAEELRSSGSCQSFTFAQVGSELACSFNEL
QKKLEVPLAKDSLDASVVTYSFDHIFPGSENNTRTVVLYGDLGSSQFRTY
HKLLEKEANAGRIRYILRHQLAKKDKRPVRLSGYGVELHLKSTEYKSQDD
APKPEAGSTSDEDLANESDVQGFDFKVLKQKHPTLKRALDQLRQRLLQGN
DEIAQLKAWEFQDLGLQAAAAIAEIQGDETLQILQYTAHNFPMLARTLLA
HKVTDGLRAEVKHNTEAFGRSLNVAPPDGALFINGLFFDADTMDLYSLIE
TLRSEMRVLESLHSNNVRGSLASSLLALDLTASSKKEFAIDIRDTAVQWV
NDIENDVQYRRWPSSVMDLLRPTFPGMLRNIRKNVFNLVLVVDALQPTAR
SVIKLSESFVIHQAPIRLGLVFDARDANEDNLADYVAITCAYNYVSQKKD
ARAALSFLTDIYAAVGETKVVTKKDIVKQLTKEFTSLSFAKAEEFLEEDS
TYDYGRELAAEFIQRLGFGDKGQPQALLNGVPMPSNVVTADSDFEEAIFT
EIMTHTSNLQKAVYKGELTDNDVAIDYLMNQPHVMPRLNQRILSQEDVKY
LDINGVAYKNLGNVGVLNRLSNRDMTATLMDNLKYFGGKKSTELIGRASL
QFLTIWVFADLETDQGRDLLTHALDYVQSGESVRVAFIPNTESSSASSRR
NLNRLVWAAMQSLPPTQATEQVLKWLKKPKEKIEIPTQLEDILGSTELHL
KMLRVYSQRVLGLNKSQRLVIGNGRLYGPLSSDESFDSADFALLARFSSL
QYSDKVRQVLKESAQDVNEEFNSDTLLKLYASLLPRQTKTRFKLPTDLKT
DHSVVKLPPKQENLPHFDVAAVLDPASRAAQKLTPILILLRQVLNCQLNL
YLIPVPQHSDMPVKNFYRYVVEPEVQFEANGGRSDGPLAKFSGLPANPLL
TQQLQVPENWLVEAVRAVYDLDNIKLTDIGGPVHSEFDLEYLLLEGHCFD
AASGAPPRGLQLVLGTQSQPTLVDTIVMANLGYFQLKANPGAWSLRLREG
KSADIYAISHIEGTNTHHSAGSSEVQVLITSLRSHVVKLRVSKKPGMQQA
ELLSDDNEQAAQSGMWNSIASSFGGGSANQAATDEDTETINIFSVASGHL
YERLLRIMMVSLLKHTKSPVKFWFLKNYLSPQFTDFLPHMASEYNFQYEL
VQYKWPRWLHQQTEKQRTIWGYKILFLDVLFPLNVRKIIFVDADAIVRTD
IKELYDMDLGGAPYAYTPFCDSRKEMEGFRFWKQGYWRSHLMGRRYHISA
LYVVDLKRFRKIAAGDRLRGQYQALSQDPNSLSNLDQDLPNNMIHQVAIK
SLPDDWLWCQTWCSDSNFKTAKVIDLCNNPQTKEAKLTAAQRIVPEWKDY
DAELKTLMSRIEDHENSHSRDSAVDDSVDDSVEVTTVTPSHEPKHGELAS
FLDH

BO28525.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-PA 1548 CG6850-PA 1..1548 1..1548 7952 100 Plus