Clone BO28528 Report

Search the DGRC for BO28528

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG10512-RA
Protein status:BO28528.pep: Imported from assembly
Sequenced Size:1372

Clone Sequence Records

BO28528.complete Sequence

1372 bp assembled on 2011-07-13

GenBank Submission: KX796261

> BO28528.complete
GAAGTTATCAGTCGACATGACTGCTTTGACATTGCTACGACGATCAGTTA
CGGCGGTCAGCTACGACGGTTACGCCCACGTTTGCGTTACGAATTGGCGG
TTTCTGCCCCAGCTTCAAAGGTGCCAATTGCATTTGCACGTTAGTGGGCG
ACATGCTGCTGTACTTTTGTCCAGCAAAACAACAGCAACAACAGCAACAT
CAGCTGTTGCAGCTGCGCAGGCGCCAAATGCGTATGCTAATGTTGGCGGC
TTTTCCATCACGTACCGCACCATGTCCGCCGCTGCTCCGAAACTGGTGGC
CGTTGCCGAGTCGCGTCGTTTCATGATCGACTGCTTCAAGGCGGTGAAGG
TGCCCCAGGCCCATGCCGAAGCCCAGGCGGATCTCCTGGTGGCTGCGGAC
CATCGGGGGCACTTCAGCCATGGCATGAACCGCCTTGAGATGTACATCAA
CGATCTGGCCATCAACTCCACGGACGGAGCGGCTGTGCCCAAGATCCTAA
AGGAAACTCCGGCCACCGCCTGGGTGGATGGCCTGAATGGACTTGGTGCC
GTCGTGGGCAACTACTGCATGGATCTGGCCATCAAGAAGGCCAAGACGGT
GGGAGTTGGCTGGGTTTGTGCCAAGGGATCGAACCACTATGGCATGGCTG
GTTGGTATGCCATCAGGGCCATGGATCAGGGTCTGGTGGGCATGTCCATG
ACGAATACCTCGCCGCTGATGGCACCCACACGCGCCAAGGAGGCTGCTCT
GGGCACCAATCCCTTGTCCCTGGGTGCCAATGCCACCAACGGTGATAAGT
TCCTGCTGGACATGGCCACCACAGCCGTGGCCGTGGGAAAGATCGAGATC
CAGCGCAGGAAGGGAGCTCCTCTGCCCGACGGATGGGCTCAGGATCCCAG
TGGTGAAGTGACCAACGATGCAGAGCTGGGTTTCAGCACTGGGTGCCTGA
TGCCATTAGGAGGATCCGAGCTGACCTCCGGCTACAAGGGTTACGGCCTT
GGCGCCATGGTGGACATTCTGTCGGGTGTCATGTCCGGAGCCAACTACTC
GACGCAGGTGAGGAAGTGGACACATGCTGGCGCCGATTCCGCAGCTGATC
TTGGCCAGGTCTTCATCGCCGTGGATCCCAACTGCTTTGCTCCCAACTTC
GAGGAACGCATGGCCGACTTCAACTCCCGCCTGCGAGGCGCTACTCCGAC
CGATCCCAGCAAGCCCGTTTTGCTGGCTGGAGACAAGGAGAAGAAGGGAA
TGGCTGACGTCGATGCCGCCGGCGGTATACAGTATCTGGAGAATCAGTTG
AAGACGTGCGCCAACCTGGCGGAAATACTGAAGATTAAGCCCCTGAGCTT
TGTTGCAAGCTTTCTAGACCAT

BO28528.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-RA 1341 CG10512-PA 1..1338 17..1354 6690 100 Plus
CG10512-RB 1146 CG10512-PB 37..1143 248..1354 5535 100 Plus
CG10512-RD 1086 CG10512-PD 1..1083 272..1354 5415 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-RA 2010 CG10512-RA 168..1509 13..1354 6695 99.9 Plus
CG10512-RD 1659 CG10512-RD 52..1158 248..1354 5535 100 Plus
CG10512-RC 1704 CG10512-RC 97..1203 248..1354 5535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21205676..21206626 248..1198 4755 100 Plus
3L 28110227 3L 21203087..21203323 13..249 1170 99.6 Plus
3L 28110227 3L 21207435..21207591 1198..1354 785 100 Plus
Blast to na_te.dros performed 2014-11-26 16:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2363 172..220 141 80.4 Plus
X-element 4740 X-element ROXELEMENT 4740bp 1747..1784 177..214 127 81.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2388..2421 172..204 122 88.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6818 172..213 122 79.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2329..2372 178..220 118 77.3 Plus
roo 9092 roo DM_ROO 9092bp 1130..1164 172..205 118 85.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2386..2421 178..213 117 80.6 Plus
roo 9092 roo DM_ROO 9092bp 1113..1148 178..213 117 80.6 Plus
TART-C 11124 TART-C TARTC 11124bp 9342..9440 111..212 115 59.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6770 171..216 114 76 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6784 172..220 114 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6805 172..220 114 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6875..6917 172..213 113 76.7 Plus

BO28528.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:10 Download gff for BO28528.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 172..1509 17..1356 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:45 Download gff for BO28528.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 172..1509 17..1356 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:28:22 Download gff for BO28528.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 172..1509 17..1356 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:28:22 Download gff for BO28528.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21207436..21207591 1199..1356 98   Plus
3L 21205677..21206626 249..1198 100 -> Plus
3L 21203091..21203322 17..248 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:45 Download gff for BO28528.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21200536..21200691 1199..1356 98   Plus
arm_3L 21198777..21199726 249..1198 100 -> Plus
arm_3L 21196191..21196422 17..248 100 -> Plus

BO28528.pep Sequence

Translation from 16 to 1372

> BO28528.pep
MTALTLLRRSVTAVSYDGYAHVCVTNWRFLPQLQRCQLHLHVSGRHAAVL
LSSKTTATTATSAVAAAQAPNAYANVGGFSITYRTMSAAAPKLVAVAESR
RFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEMYINDLAIN
STDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAKTVGVGWV
CAKGSNHYGMAGWYAIRAMDQGLVGMSMTNTSPLMAPTRAKEAALGTNPL
SLGANATNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQDPSGEVTN
DAELGFSTGCLMPLGGSELTSGYKGYGLGAMVDILSGVMSGANYSTQVRK
WTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFNSRLRGATPTDPSKP
VLLAGDKEKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPLSFVASFL
DH

BO28528.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-PA 446 CG10512-PA 1..446 1..446 2308 100 Plus
CG10512-PB 381 CG10512-PB 13..381 78..446 1916 100 Plus
CG10512-PD 361 CG10512-PD 1..361 86..446 1874 100 Plus
CG10512-PC 361 CG10512-PC 1..361 86..446 1874 100 Plus
CG18808-PA 385 CG18808-PA 25..372 85..443 625 38.8 Plus