Clone BO28529 Report

Search the DGRC for BO28529

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptPrm-RA
Protein status:BO28529.pep: Imported from assembly
Sequenced Size:2671

Clone Sequence Records

BO28529.complete Sequence

2671 bp assembled on 2011-08-04

GenBank Submission: KX799108

> BO28529.complete
GAAGTTATCAGTCGACATGTCGTCATCGCAGGCTGTCCGCTCCTCGAAAT
ACTCCTACCGTGCCACGTCCACCGGACCCGGTACCGCCGATGTGAACATC
GAGTACATCCAGGACCTGAGCTCGCTCTCCCGCTTGGAGGACAAGATCCG
TTTGCTCCAAGATGATCTTGAAGTTGAACGTGAGTTGCGCCAAAGGATCG
AGCGCGAGAAAGCCGATCTCAGCGTTCAGGTCATTCAGATGTCCGAGCGT
CTCGAGGAGGCCGAGGGTGGTGCTGAACATCAATTTGAAGCCAACCGCAA
GCGCGACGCTGAGCTGCTGAAGCTGCGCAAGCTGCTTGAGGATGTTCATC
TTGAGTCGGAGGAGACCACTTTGCTTTTGAAGAAAAAGCACAACGAAATT
ATCACGGATTTCCAGGAACAGGTTGAAATCCTAACGAAAAACAAGGCCAG
AGCCGAAAAGGACAAGGCCAAATTCCAGACCGAAGTCTACGAGCTGCTCT
CCCAGATCGAGTCCTACAACAAGGAGAAGATCGTGTCGGAGAAGCACATC
TCCAAACTGGAGGTCTCGATCTCCGAGCTCAACGTGAAGATCGAGGAGCT
TAACCGCACCGTTATCGACATTAGCTCCCACCGATCCCGCCTCTCGCAGG
AGAACATTGAGCTGACCAAGGACGTCCAAGATCTGAAGGTTCAGCTGGAC
ACGGTCTCGTTCTCCAAGAGCCAGGTCATTTCCCAGCTGGAGGACGCCCG
CCGTCGCTTGGAGGACGAGGACCGTCGTCGCTCGCTGCTCGAATCCTCTC
TGCATCAGGTTGAGATCGAATTGGACTCGGTTCGTAATCAACTCGAGGAG
GAGTCCGAGGCCCGCATCGACTTGGAACGTCAGTTGGTCAAGGCCAATGC
CGATGCCACCTCCTGGCAGAACAAGTGGAACTCCGAGGTGGCTGCCCGCG
CCGAGGAGGTCGAGGAGATCCGTCGCAAGTACCAGGTCCGCATCACCGAG
CTGGAGGAGCACATCGAGTCCCTCATCGTCAAGGTCAACAATCTGGAGAA
GATGAAGACGCGCCTGGCCAGCGAAGTGGAGGTGCTCATCATCGATCTGG
AGAAGTCGAACAACAGCTGCCGCGAGCTGACCAAGTCGGTCAACACCCTC
GAGAAGCACAACGTTGAGCTGAAGAGCCGTCTGGACGAGACCATCATCCT
GTACGAGACCAGCCAGCGCGACCTGAAGAACAAGCACGCCGACCTCGTCC
GCACTGTCCACGAACTGGACAAGGTCAAGGACAACAACAACCAGCTGACC
CGCGAGAACAAGAAACTGGGAGATGATCTTCATGAGGCCAAGGGTGCCAT
CAACGAACTGAACCGTCGTCTGCACGAATTGGAACTGGAGCTGCGTCGTC
TGGAGAACGAGCGTGATGAGCTGACCGCTGCCTACAAGGAAGCCGAGGCT
GGCCGCAAGGCTGAGGAGCAGCGCGGACAGCGCCTGGCCGCCGACTTCAA
CCAGTACCGCCACGACGCCGAGCGTCGTCTGGCCGAGAAGGATGAGGAGA
TCGAGGCCATTCGCAAGCAGACCTCGATCGAGATCGAGCAGCTCAATGCC
CGCGTCATCGAGGCGGAGACCCGGCTGAAGACCGAGGTGACCCGCATCAA
GAAGAAGCTGCAGATCCAGATCACCGAGCTGGAGATGTCGCTGGATGTGG
CCAACAAGACCAACATCGATCTGCAGAAGGTGATCAAGAAGCAGTCGCTG
CAGCTGACCGAACTGCAGGCCCACTACGAGGATGTCCAGCGCCAGTTGCA
GGCCACCTTGGACCAGTATGCCGTTGCCCAGCGCCGTCTGGCCGGTCTCA
ATGGCGAGCTGGAGGAGGTGCGCTCGCACCTGGACAGCGCCAACCGTGCC
AAGCGCACCGTGGAGCTGCAGTACGAGGAGGCTGCCTCCCGCATCAACGA
ACTGACCACCGCCAATGTCAGCCTCGTCTCCATCAAGTCCAAGCTGGAGC
AGGAGCTCTCCGTGGTCGCCTCCGACTACGAGGAGGTGTCCAAGGAGCTG
CGCATCAGCGACGAGCGCTACCAGAAGGTCCAGGTGGAGCTCAAGCATGT
CGTCGAGCAGGTGCATGAGGAGCAGGAGCGCATCGTTAAGCTGGAGACCA
TCAAGAAGTCCTTGGAAGTCGAAGTCAAGAACTTGTCCATCCGCTTGGAG
GAGGTCGAGCTGAACGCCGTCGCCGGCAGCAAGCGCATCATCAGCAAGCT
GGAAGCCCGCATCCGCGATCTGGAGCTGGAGCTGGAGGAGGAGAAGCGCC
GCCACGCCGAGACCATCAAGATTCTGCGCAAGAAGGAGCGCACCGTCAAG
GAGGTGCTGGTGCAGTGCGAGGAGGACCAGAAGAACCTCATCCTGCTGCA
GGACGCGCTGGACAAGTCCACTGCCAAGATCAACATCTACCGCCGCCAGC
TGTCCGAGCAGGAGGGTGTCTCCCAGCAGACCACCACCCGTGTGCGCCGC
TTCCAGCGCGAGCTGGAGGCTGCCGAGGATCGCGCCGACACCGCCGAGTC
CAGCCTGAACATCATCCGCGCCAAGCACCGCACATTCGTCACCACCTCGA
CGGTGCCCGGATCCCAGGTGTACATCCAGGAGACCACAAGGACGATCACC
GAAGCAAGCTTTCTAGACCAT

BO28529.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-RA 2640 CG5939-PA 1..2637 17..2653 13185 100 Plus
Prm-RB 2640 CG5939-PB 1..2637 17..2653 13185 100 Plus
Prm-RD 1923 CG5939-PD 830..1920 1563..2653 5455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-RA 3661 CG5939-RA 224..2862 15..2653 13195 100 Plus
Prm-RB 3226 CG5939-RB 224..2862 15..2653 13195 100 Plus
Prm-RD 2720 CG5939-RD 1266..2356 1563..2653 5455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8739580..8740454 1322..448 4375 100 Minus
3L 28110227 3L 8734240..8734856 2179..1563 3085 100 Minus
3L 28110227 3L 8733657..8734132 2653..2178 2380 100 Minus
3L 28110227 3L 8742106..8742272 450..284 835 100 Minus
3L 28110227 3L 8739366..8739496 1451..1321 655 100 Minus
3L 28110227 3L 8744962..8745087 140..15 630 100 Minus
3L 28110227 3L 8739170..8739282 1563..1451 565 100 Minus
3L 28110227 3L 8742337..8742424 283..196 440 100 Minus
3L 28110227 3L 8744275..8744338 196..133 305 98.4 Minus
Blast to na_te.dros performed on 2014-11-27 00:55:14 has no hits.

BO28529.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:51 Download gff for BO28529.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RA 263..2899 17..2655 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:38:34 Download gff for BO28529.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RB 226..2862 17..2655 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:13:36 Download gff for BO28529.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RB 226..2862 17..2655 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:13:36 Download gff for BO28529.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8744963..8745085 17..139 100   Minus
3L 8744275..8744331 140..196 100 <- Minus
3L 8742337..8742423 197..283 100 <- Minus
3L 8742106..8742272 284..450 100 <- Minus
3L 8739580..8740451 451..1322 100 <- Minus
3L 8739367..8739494 1323..1450 100 <- Minus
3L 8739170..8739282 1451..1563 100 <- Minus
3L 8734240..8734855 1564..2179 100 <- Minus
3L 8733655..8734130 2180..2655 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:38:34 Download gff for BO28529.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8738063..8738185 17..139 100   Minus
arm_3L 8737375..8737431 140..196 100 <- Minus
arm_3L 8735437..8735523 197..283 100 <- Minus
arm_3L 8735206..8735372 284..450 100 <- Minus
arm_3L 8732680..8733551 451..1322 100 <- Minus
arm_3L 8732467..8732594 1323..1450 100 <- Minus
arm_3L 8732270..8732382 1451..1563 100 <- Minus
arm_3L 8727340..8727955 1564..2179 100 <- Minus
arm_3L 8726755..8727230 2180..2655 99 <- Minus

BO28529.pep Sequence

Translation from 16 to 2671

> BO28529.pep
MSSSQAVRSSKYSYRATSTGPGTADVNIEYIQDLSSLSRLEDKIRLLQDD
LEVERELRQRIEREKADLSVQVIQMSERLEEAEGGAEHQFEANRKRDAEL
LKLRKLLEDVHLESEETTLLLKKKHNEIITDFQEQVEILTKNKARAEKDK
AKFQTEVYELLSQIESYNKEKIVSEKHISKLEVSISELNVKIEELNRTVI
DISSHRSRLSQENIELTKDVQDLKVQLDTVSFSKSQVISQLEDARRRLED
EDRRRSLLESSLHQVEIELDSVRNQLEEESEARIDLERQLVKANADATSW
QNKWNSEVAARAEEVEEIRRKYQVRITELEEHIESLIVKVNNLEKMKTRL
ASEVEVLIIDLEKSNNSCRELTKSVNTLEKHNVELKSRLDETIILYETSQ
RDLKNKHADLVRTVHELDKVKDNNNQLTRENKKLGDDLHEAKGAINELNR
RLHELELELRRLENERDELTAAYKEAEAGRKAEEQRGQRLAADFNQYRHD
AERRLAEKDEEIEAIRKQTSIEIEQLNARVIEAETRLKTEVTRIKKKLQI
QITELEMSLDVANKTNIDLQKVIKKQSLQLTELQAHYEDVQRQLQATLDQ
YAVAQRRLAGLNGELEEVRSHLDSANRAKRTVELQYEEAASRINELTTAN
VSLVSIKSKLEQELSVVASDYEEVSKELRISDERYQKVQVELKHVVEQVH
EEQERIVKLETIKKSLEVEVKNLSIRLEEVELNAVAGSKRIISKLEARIR
DLELELEEEKRRHAETIKILRKKERTVKEVLVQCEEDQKNLILLQDALDK
STAKINIYRRQLSEQEGVSQQTTTRVRRFQRELEAAEDRADTAESSLNII
RAKHRTFVTTSTVPGSQVYIQETTRTITEASFLDH

BO28529.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-PA 879 CG5939-PA 1..879 1..879 4268 100 Plus
Prm-PB 879 CG5939-PB 1..879 1..879 4268 100 Plus
Prm-PD 640 CG5939-PD 256..640 499..879 1740 95.1 Plus
Prm-PC 640 CG5939-PC 256..640 499..879 1740 95.1 Plus
Mhc-PU 1949 CG17927-PU 1095..1924 25..855 1515 38.1 Plus
Prm-PD 640 CG5939-PD 125..620 145..655 230 21.3 Plus
Prm-PC 640 CG5939-PC 125..620 145..655 230 21.3 Plus
Prm-PD 640 CG5939-PD 208..621 7..413 173 22.1 Plus
Prm-PC 640 CG5939-PC 208..621 7..413 173 22.1 Plus