Clone BO28530 Report

Search the DGRC for BO28530

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG7995-RC
Protein status:BO28530.pep: Imported from assembly
Sequenced Size:1762

Clone Sequence Records

BO28530.complete Sequence

1762 bp assembled on 2011-08-04

GenBank Submission: KX794771

> BO28530.complete
GAAGTTATCAGTCGACATGACCGAGGGCAAGAACTTACCCCACTCTAGTG
CGGATGTGCCGTTCCGCAGCAAGGAGCTGCGCAAGCAATCGCTCATCCAG
CACACCGGCCTGGTCGGAGTCATCGATGAGGGCACCAAGACCATCGGTTT
CTCCATCTACACCACGCCGGACTTCAAGGAGATCGCCGCACACCGGGTGG
AGCTGAGCGTGATCACGCCCCAGGATGGCTGGTATGAGCAGGATCCGCTG
GAGATGATGGCCTCGATCAACAAGTGCGCCGAGGAGGCCATCAAGCAGCT
ACCCGAACAGGGTTTCTCTGCCAGCGACATTGTCACCGTGGGCATAACCA
ACCAGCGCGAGACGACAATCGTCTGGGATGCGGTCACCGGCAAACCGCTG
TACAATGCGCTCCTGTGGAAGGACATCCGCACTAGCACTACAGTGGAGCA
GATCGTGGCCAAGGTGCAGGATCCGAACCACTTCCGCAGCAGCACTGGCC
TGCCCATCTCCACGTACTTCTCGGCCCTCAAGATCCGCTGGCTGCGGGAC
AATGTGCCCGAGGTGCGACAGGCCATCCGGGAAAGGCGATGCAAGGCGGG
CACAGTCGACAGCTGGATCGTCTGGAACTTGACAAACGGAGCTCTCCACA
TCACGGATGTAACGAATGCCTCCCGCACTCTGCTCATGAATCTGGAGACG
CAAGCCTGGGATCCTGTTCTGCTCAAGACGTTCGGTATCAGAGAGGAGAT
GCTGCCCACCATCCACAGCTGTTCGGAGATATTTGGCAAGATCACTTCGG
AGCGAAGTCCACTGCGTGGGATGACCCTAAGTGGAATAATGGGCAACCAG
CAGGCCTCGCTTCTGGGCCAGATGTGCGTGAAGCCGGGTCAAACGAAGAA
CACCTACCGATCCGGCTGTTTTCTGCTCTGCAATACGGGGGACAAGCCGG
TCTTTTCCAGGCACGGTCTGCTCACCACCGTGGCTTACAAACTCGGTCCC
CAGGCACCGACGATTTACGCAATTGAGGGAGCTGTGTCGGTGGCCGGACA
TGCGCTGTCCTGGCTGCAAAACAAGGTGCGTATCCTGCCGGACTCCAGAG
ATGCCGAGAAATATGCGGAGATGGTGCCCACATCGGGGGATGTGTACTTC
GTGCCCGCCTTTACAGGACTATATGCTCCCTACTGGCGGCAGAATGCTCG
CGGCATCATCATTGGGCTCACGCAGTTCACCCGTAAGAATCACATAGTGA
GAGCTGCACTGGAGAGCATCTGCTTCCAGACGCGCGACATCCTAGAGTGC
ATGCATCAGGAGTGCGGTTACGAAATCAATAAGCTTCATGCTGATGGCAA
GCTCACCACGAACAACCTGTTGATGCAACTCCAGGCGGACACCATTGGCA
TGCCCGTCTTCCGCTCCCAGCTAATGGACTCCACCGCTTTCGGGGCAGCC
ATGTGCGCCGCCCAGGCAGATGGTGTCAATCTCTGCCAGTTCGAGCCTGA
GAAGCGATACTACGAGAACGTGCACTACGACACCTTCCTGGCCACCACCA
CGGATGTAGAGCGAAAGGAGCGATACGGCAAGTGGAAGCGGGCGGTGGAG
CGCAGTTTGGGATGGGTCATCAAGCAGAAGAAGACGCGTGAGTACACGGA
GGAGAACTACCGCATGCTGTCCTCTCTGCCAGCGAGCATCTTCCTCATCA
GCAGCTTCGCCATGCTGGTGCATTCCCTCGCTGCGAGTGGCCAGGCAAGC
TTTCTAGACCAT

BO28530.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Gk-RF 1731 CG7995-PF 1..1728 17..1744 8640 100 Plus
Gk-RA 1731 CG7995-PA 1..1728 17..1744 8640 100 Plus
Gk-RB 1731 CG7995-PB 1..1728 17..1744 8640 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Gk-RD 2260 CG7995-RD 119..1848 15..1744 8650 100 Plus
Gk-RF 2483 CG7995-RF 343..2071 16..1744 8645 100 Plus
Gk-RA 2318 CG7995-RA 178..1906 16..1744 8645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1743903..1745009 638..1744 5535 100 Plus
3L 28110227 3L 1743212..1743835 16..639 3120 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:55:36 has no hits.

BO28530.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:51 Download gff for BO28530.complete
Subject Subject Range Query Range Percent Splice Strand
CG7995-RD 121..1848 17..1746 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:38:48 Download gff for BO28530.complete
Subject Subject Range Query Range Percent Splice Strand
Gk-RD 121..1848 17..1746 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:13:46 Download gff for BO28530.complete
Subject Subject Range Query Range Percent Splice Strand
Gk-RD 121..1848 17..1746 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:13:46 Download gff for BO28530.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1743904..1745009 639..1746 99   Plus
3L 1743213..1743834 17..638 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:38:48 Download gff for BO28530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1743904..1745009 639..1746 99   Plus
arm_3L 1743213..1743834 17..638 100 -> Plus

BO28530.pep Sequence

Translation from 16 to 1762

> BO28530.pep
MTEGKNLPHSSADVPFRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTT
PDFKEIAAHRVELSVITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGF
SASDIVTVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKV
QDPNHFRSSTGLPISTYFSALKIRWLRDNVPEVRQAIRERRCKAGTVDSW
IVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFGIREEMLPTIH
SCSEIFGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSG
CFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWL
QNKVRILPDSRDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQNARGIIIG
LTQFTRKNHIVRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNN
LLMQLQADTIGMPVFRSQLMDSTAFGAAMCAAQADGVNLCQFEPEKRYYE
NVHYDTFLATTTDVERKERYGKWKRAVERSLGWVIKQKKTREYTEENYRM
LSSLPASIFLISSFAMLVHSLAASGQASFLDH

BO28530.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Gk-PF 576 CG7995-PF 1..576 1..576 3010 100 Plus
Gk-PA 576 CG7995-PA 1..576 1..576 3010 100 Plus
Gk-PB 576 CG7995-PB 1..576 1..576 3010 100 Plus
Gk-PD 576 CG7995-PD 1..576 1..576 3010 100 Plus
Gk-PE 576 CG7995-PE 1..576 1..576 3010 100 Plus