Clone BO28536 Report

Search the DGRC for BO28536

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:36
Vector:pDNR-Dual
Associated Gene/Transcripttankyrase-RA
Protein status:BO28536.pep: Imported from assembly
Sequenced Size:3577

Clone Sequence Records

BO28536.complete Sequence

3577 bp assembled on 2011-08-31

GenBank Submission: KX795243

> BO28536.complete
GAAGTTATCAGTCGACATGGCCAACAGCAGCCGAAGTCGGGCCATTTTGA
GCGTTAATCTCGATGCGGTCATGGCCAACGATCCGCTGAGGGAGCTCTTC
GAGGCCTGCAAAACGGGCGAGATCGCCAAGGTGAAGAAGCTAATAACGCC
TCAGACCGTGAACGCCAGGGATACGGCGGGACGCAAATCCACACCATTGC
ATTTCGCAGCGGGTTATGGACGCCGGGAAGTGGTTGAATTCCTGCTGAAC
AGCGGCGCCTCCATACAGGCGTGTGACGAGGGTGGGCTGCACCCGCTGCA
CAACTGTTGCTCCTTTGGCCACGCCGAGGTAGTTCGATTGTTGCTGAAGG
CAGGTGCCAGTCCAAACACCACCGACAACTGGAACTACACGCCATTGCAC
GAGGCGGCCAGCAAGGGCAAGGTGGATGTGTGCCTGGCTCTGTTGCAGCA
TGGCGCAAACCATACGATCCGCAACTCGGAGCAGAAGACACCACTGGAGC
TGGCGGACGAGGCGACGCGTCCCGTATTGACCGGCGAATATCGAAAGGAT
GAGCTGCTTGAAGCCGCACGCTCGGGGGCCGAGGATCGCCTGCTGGCCCT
ACTCACGCCACTCAATGTCAACTGTCATGCCAGCGATGGACGACGCTCAA
CGCCGCTCCATCTGGCAGCGGGCTACAATCGGATCGGCATCGTGGAAATT
CTGCTGGCCAACGGAGCGGATGTACATGCTAAGGACAAGGGCGGTCTGGT
GCCGCTGCACAATGCCTGCTCCTACGGACACTTCGATGTGACCAAGCTGC
TTATCCAGGCGGGCGCCAATGTCAACGCCAACGATCTGTGGGCCTTTACG
CCGCTCCACGAGGCCGCCTCCAAAAGTCGCGTCGAGGTCTGCAGCCTGCT
GCTCAGTCGTGGAGCGGATCCCACCCTCCTAAACTGCCACAGCAAGTCGG
CCATCGATGCGGCGCCCACCAGGGAGCTGAGAGAGCGGATTGCCTTTGAA
TACAAGGGTCACTGCCTGCTGGACGCCTGTCGAAAGTGTGATGTGTCCCG
TGCCAAGAAGCTGGTATGCGCAGAGATTGTTAACTTCGTGCATCCATATA
CAGGAGACACTCCGCTCCACCTGGCCGTTGTCAGTCCGGATGGGAAGCGC
AAGCAGCTGATGGAACTGCTGACCAGAAAGGGATCCTTGCTGAACGAGAA
AAACAAGGCTTTCCTCACGCCCCTGCATTTGGCTGCCGAGCTGCTTCACT
ACGATGCCATGGAGGTGCTGCTAAAGCAGGGCGCCAAGGTTAATGCATTG
GACAGTCTTGGACAAACGCCACTGCATCGGTGCGCCCGTGATGAGCAAGC
GGTGCGACTGCTGCTCTCGTACGCAGCGGACACGAATATCGTTTCCCTTG
AGGGACTTACGGCCGCTCAATTGGCCTCGGACAGCGTGCTGAAGCTGCTC
AAGAATCCTCCGGACAGTGAGACACATTTACTGGAGGCAGCCAAGGCGGG
AGATCTGGACACTGTGCGCCGTATAGTGCTCAACAATCCGATTTCGGTCA
ATTGCCGGGATTTGGACGGACGACATTCCACACCTTTGCACTTTGCTGCT
GGGTTTAATAGAGTGCCAGTGGTTCAGTTTCTTTTGGAACACGGCGCCGA
GGTTTATGCGGCTGACAAGGGCGGACTGGTGCCCCTGCACAATGCCTGCT
CTTATGGGCACTATGAGGTAACCGAACTGCTGGTCAAGCACGGAGCCAAT
GTAAATGTATCGGATTTGTGGAAGTTTACTCCTCTTCATGAAGCTGCCGC
CAAGGGAAAGTATGATATTTGCAAGCTGCTCTTGAAACATGGCGCTGATC
CAATGAAGAAGAATCGGGATGGCGCGACACCAGCGGATTTGGTTAAGGAA
TCTGATCACGATGTTGCAGAGCTGCTGAGAGGACCGTCCGCTCTGCTAGA
CGCAGCAAAGAAAGGAAACTTGGCACGGGTACAGCGATTGGTTACACCGG
AATCCATTAATTGCCGGGACGCGCAGGGCAGGAATTCCACACCACTTCAC
CTGGCCGCCGGATATAACAACTTTGAGTGTGCCGAGTACCTTCTGGAGAA
TGGAGCCGATGTTAATGCACAGGACAAGGGGGGACTAATACCTCTGCACA
ATGCCAGCAGCTATGGGCATTTGGATATTGCGGCACTGCTAATTAAGCAC
AAGACGGTTGTCAATGCGACAGATAAATGGGGATTCACACCGCTCCACGA
GGCTGCACAGAAGGGGCGCACTCAATTGTGCTCGCTCTTGTTGGCCCACG
GTGCCGATGCCTATATGAAAAACCAGGAGGGGCAGACGCCCATTGAGTTG
GCCACGGCAGATGATGTTAAGTGCTTGCTCCAGGACGCGATGGCCACCTC
GTTGAGTCAACAGGCGTTGAGTGCTTCCACGCAATCGCTGACAAGCAGTT
CCCCGGCACCAGATGCAACTGCTGCTGCGGCTCCGGGCACATCTTCATCG
TCCTCATCCGCAATCCTATCGCCCACCACGGAAACGGTGTTGCTGCCCAC
CGGTGCCTCCATGATTCTGAGTGTTCCTGTTCCACTTCCACTGTCCAGTA
GCACGCGCATCAGTCCCGCCCAAGGAGCAGAGGCCAATGGGGCTGAGGGC
TCCTCTTCGGATGATCTACTGCCGGATGCGGATACCATAACAAATGTGTC
CGGATTCCTAAGCAGCCAGCAGCTGCATCATCTAATCGAACTGTTCGAGC
GCGAACAAATCACCTTGGACATTCTAGCCGAGATGGGCCACGACGATCTC
AAGCAGGTGGGCGTCTCCGCCTACGGCTTCCGCCACAAGATACTCAAGGG
AATCGCCCAGCTGAGGTCCACCACAGGCATTGGTAACAACGTGAATCTAT
GCACATTGTTGGTGGACTTGCTGCCGGACGATAAGGAGTTTGTGGCCGTC
GAGGAGGAGATGCAGGCCACGATTCGTGAACATCGTGATAATGGACAGGC
TGGAGGTTATTTCACTCGATATAACATCATTCGGGTGCAAAAGGTACAAA
ATCGAAAGCTGTGGGAGCGTTATGCTCATCGACGGCAAGAGATCGCCGAG
GAGAATTTCCTGCAGTCCAACGAGCGTATGCTCTTCCACGGTAGTCCCTT
CATCAACGCAATTGTGCAACGCGGATTCGACGAGCGCCACGCCTACATTG
GCGGCATGTTTGGGGCTGGCATTTATTTCGCCGAGCATAGCTCGAAAAGC
AACCAGTATGTGTACGGAATTGGCGGCGGCATTGGCTGTCCCTCGCACAA
GGATAAGTCCTGCTACGTGTGTCCTAGACAATTGCTGCTGTGCCGAGTGG
CGTTAGGCAAATCCTTCTTGCAATACAGTGCAATGAAGATGGCCCATGCA
CCGCCGGGACACCACTCGGTGGTGGGCAGACCCTCGGCGGGTGGCTTGCA
TTTCGCCGAATACGTTGTCTATCGGGGCGAACAGTCTTATCCGGAGTACT
TGATAACCTACCAAATCGTCAAGCCCGATGACAGCAGTAGTGGAACGGAG
GATACAAGAGCAAGCTTTCTAGACCAT

BO28536.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
Tnks-RB 4563 CG4719-PB 1..3543 17..3559 17715 100 Plus
Tnks-RA 3546 CG4719-PA 1..3543 17..3559 17715 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Tnks-RB 5486 CG4719-RB 500..4042 17..3559 17715 100 Plus
Tnks-RA 5486 CG4719-RA 500..4042 17..3559 17715 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25655469..25657350 2877..996 9410 100 Minus
3R 32079331 3R 25657411..25658198 999..212 3925 99.9 Minus
3R 32079331 3R 25654895..25655188 3327..3034 1470 100 Minus
3R 32079331 3R 25660590..25660787 214..17 990 100 Minus
3R 32079331 3R 25655250..25655411 3036..2875 810 100 Minus
3R 32079331 3R 25654670..25654828 3484..3326 795 100 Minus
3R 32079331 3R 25654535..25654612 3559..3482 390 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:23:04 has no hits.

BO28536.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-31 09:30:38 Download gff for BO28536.complete
Subject Subject Range Query Range Percent Splice Strand
tankyrase-RA 495..4037 17..3561 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:52:32 Download gff for BO28536.complete
Subject Subject Range Query Range Percent Splice Strand
Tnks-RA 500..4042 17..3561 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:24:23 Download gff for BO28536.complete
Subject Subject Range Query Range Percent Splice Strand
Tnks-RA 500..4042 17..3561 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:24:23 Download gff for BO28536.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25660592..25660787 17..212 100   Minus
3R 25657415..25658197 213..995 100 <- Minus
3R 25655470..25657350 996..2876 100 <- Minus
3R 25655252..25655409 2877..3034 100 <- Minus
3R 25654895..25655187 3035..3327 100 <- Minus
3R 25654670..25654826 3328..3484 100 <- Minus
3R 25654532..25654609 3485..3561 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:52:32 Download gff for BO28536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21486314..21486509 17..212 100   Minus
arm_3R 21483137..21483919 213..995 100 <- Minus
arm_3R 21481192..21483072 996..2876 100 <- Minus
arm_3R 21480974..21481131 2877..3034 100 <- Minus
arm_3R 21480617..21480909 3035..3327 100 <- Minus
arm_3R 21480392..21480548 3328..3484 100 <- Minus
arm_3R 21480254..21480331 3485..3561 97 <- Minus

BO28536.pep Sequence

Translation from 16 to 3577

> BO28536.pep
MANSSRSRAILSVNLDAVMANDPLRELFEACKTGEIAKVKKLITPQTVNA
RDTAGRKSTPLHFAAGYGRREVVEFLLNSGASIQACDEGGLHPLHNCCSF
GHAEVVRLLLKAGASPNTTDNWNYTPLHEAASKGKVDVCLALLQHGANHT
IRNSEQKTPLELADEATRPVLTGEYRKDELLEAARSGAEDRLLALLTPLN
VNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNA
CSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGA
DPTLLNCHSKSAIDAAPTRELRERIAFEYKGHCLLDACRKCDVSRAKKLV
CAEIVNFVHPYTGDTPLHLAVVSPDGKRKQLMELLTRKGSLLNEKNKAFL
TPLHLAAELLHYDAMEVLLKQGAKVNALDSLGQTPLHRCARDEQAVRLLL
SYAADTNIVSLEGLTAAQLASDSVLKLLKNPPDSETHLLEAAKAGDLDTV
RRIVLNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLLEHGAEVYAAD
KGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYD
ICKLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKG
NLARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVN
AQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKG
RTQLCSLLLAHGADAYMKNQEGQTPIELATADDVKCLLQDAMATSLSQQA
LSASTQSLTSSSPAPDATAAAAPGTSSSSSSAILSPTTETVLLPTGASMI
LSVPVPLPLSSSTRISPAQGAEANGAEGSSSDDLLPDADTITNVSGFLSS
QQLHHLIELFEREQITLDILAEMGHDDLKQVGVSAYGFRHKILKGIAQLR
STTGIGNNVNLCTLLVDLLPDDKEFVAVEEEMQATIREHRDNGQAGGYFT
RYNIIRVQKVQNRKLWERYAHRRQEIAEENFLQSNERMLFHGSPFINAIV
QRGFDERHAYIGGMFGAGIYFAEHSSKSNQYVYGIGGGIGCPSHKDKSCY
VCPRQLLLCRVALGKSFLQYSAMKMAHAPPGHHSVVGRPSAGGLHFAEYV
VYRGEQSYPEYLITYQIVKPDDSSSGTEDTRASFLDH

BO28536.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Tnks-PB 1520 CG4719-PB 1..1181 1..1181 6113 100 Plus
Tnks-PA 1181 CG4719-PA 1..1181 1..1181 6113 100 Plus
Ank2-PW 1309 CG42734-PW 158..951 20..807 774 30.3 Plus
Ank2-PZ 4233 CG42734-PZ 158..951 20..807 774 30.3 Plus
Ank2-PN 1159 CG34416-PN 18..801 30..807 770 30.4 Plus
Ank2-PN 1159 CG34416-PN 7..141 669..799 177 32.6 Plus