Clone BO28539 Report

Search the DGRC for BO28539

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptCG7441-RA
Protein status:BO28539.pep: Imported from assembly
Sequenced Size:2029

Clone Sequence Records

BO28539.complete Sequence

2029 bp assembled on 2011-08-04

GenBank Submission: KX796352

> BO28539.complete
GAAGTTATCAGTCGACATGTTCCGATTTGGCAAGCTCCATCGCAGTCTGT
CTAAGGTGGCCAAAAAGGGACAGACAGCTGTGTATTCCCAGCGCCGTTGC
ATTCAGGCGAGGAGTTTCTTGCCGGGATTGGCTAGTAGGACGGCTGGAAC
GCCCTCTGCGACGGCCCAGGTAACCGGTGGAAACAAGCAGCACGTACACC
CCCATGGTAATTCCGTTAACAGTGGCCACGAAGAACATAACACCCGCTGG
CCGAGGAAAGTCTTTAGTGGCATCCAGCCGACGGGTTCCCTGCATCTGGG
TAATTATCTCGGCGCCGTGCGCAAATGGGTGCAGCTGCAGAATGCTCGTG
ACGATGTCACCGTGTGTATTGTGGATTTGCACTCTATTACCATGCCCCAC
AATCCGCCGCTTCTGCGAGAGAACATCTTCACCATGGCCGCCACGTTGTT
GGCATGTGGCATCGATCCCACCAAGAGCACCCTCTTTGTCCAGTCCGCCG
TTGCCGAGCACGCCGAGTTCAATTGGATCCTTAGCTCCTTGACCACCATG
CCGCGATTGGCTCAACTGCCGCAGTTCCGAGAGAAGTCCCGTCTTCTAAA
GGATGTCCCTCTGGGATTGTACGTTTACCCGGTTCTCCAAGCAGCCGACA
TTATGCTTTACAAGTCCACTCATGTTCCTGTGGGCGCTGACCAGATTCAG
CACATTCAGCTGGCCCAGCACTTGGCCAGAATTTATAACGGTCGCTATGG
CGAGACTTTCCCTGTTTGCACCGCCATCATTGAGGATGGTGATGCCTCCC
GTGTGCTGTCCCTGCGAGATCCCTCCAAAAAGATGTCTAAATCGGAAGCG
AATCCCAAGGCCACCATCAACTTGTGTGACTCGCCCGACTTGATTACGCA
GAAGATAAAGAAAGCCGTCACAGACTTTACATCGGACATTACTTATAATC
CTGGCAAGCGTGCTGGCGTCAGCAATCTGGTCAACATCCATGCCCAGGTC
ACGGGACAGAGCATTAAGACAGTGGTGAACGAGGCCGCCACTTTGGACAC
GGCAAAGTATAAGGACCGTGTGGCGGAGGCTGTGGTCGAGCACTTGCGTC
CGATCCGAGAACAGATACACCATCACATGACTAAGCGCAACGAGATGATC
TACTTGCTGGAAGTGGGTGCAGAAAAGGCACGTCAGCAGGCACGCCAAAC
GTTGAACGATGTTAAACAGCGCCTAGGACTAGGAACCAGTGCCAACATTC
CGGCTGCGGTGCATGTGGCTCCACTTCTGCCCGCACCCGATATTTCCAAA
ACCTCAGCAAGCAGGCGAATGTCCAAGGACTTCGACGGGAATGTCCACGA
GCGTCACGAACGGATGTACGGATTCGGAGATCAGCCAAGCGGAGGAGCTG
GTCAGTCAGCCACCGGCGAGGTGGCGGATATGCCTCAGGCCGTTGTACCG
CGGGTGATCCGTCGGGCGCCCATCGTTCCCACTCAGTCTATGCGCGTAGA
GAAACAACTAGGTAGCACTCGAACTCGGCACGTATTCCAGATGGACACCT
GCAATGCTCCGCATATAGGGTTCAAACCGCCGCCAGGATTTTCGGCCAGC
ATGGTCACCGGTGCTCTAGCCAAGAACAAGCGCGCTACAGTTAAACCCGT
TACTGGCAACCTGGGCTTCGGCCAGCAATCGCAGGGTGGCTCTTACAAGC
ACAGCCAGAACGTGAATCCTAGTGCGGTATCCACCATTGCACGTGAAGTA
AACGCTGCTAAGAAGCAGGAGTTTACCTGCAACCCCGCTTTGTACGGCTC
TGCCTTAGAATCGCTTTCCAATTCAAGTCGCTCGAGCGAAAAGACTAACT
CTACGGCAGGAGACAGTGAGTTCATAATTGTCGCGAGCGAGGAGGAAGAG
CAGGCTGCTTCCTCTGAGGAGCAACGCGAAGAAGCTGAAGAGGAGGAGTC
CGGGGAACGTGAAAGGGAGAAAGGCGAGCGCAACGCCACTGAAGCTACCA
AAGTCGAGATTGCAAGCTTTCTAGACCAT

BO28539.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-RB 1998 CG7441-PB 1..1995 17..2011 9975 100 Plus
CG7441-RA 1998 CG7441-PA 1..1995 17..2011 9975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-RB 2213 CG7441-RB 154..2148 17..2011 9975 100 Plus
CG7441-RA 2477 CG7441-RA 154..2148 17..2011 9975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:55:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17850777..17852124 664..2011 6740 100 Plus
3L 28110227 3L 17850161..17850590 236..665 2150 100 Plus
3L 28110227 3L 17849880..17850098 17..235 1095 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:55:51 has no hits.

BO28539.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:52 Download gff for BO28539.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 191..2180 22..2013 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:38:57 Download gff for BO28539.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 159..2148 22..2013 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:13:52 Download gff for BO28539.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 159..2148 22..2013 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:13:52 Download gff for BO28539.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17850777..17852124 664..2013 99   Plus
3L 17850161..17850588 236..663 100 -> Plus
3L 17849885..17850098 22..235 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:38:57 Download gff for BO28539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17843877..17845224 664..2013 99   Plus
arm_3L 17843261..17843688 236..663 100 -> Plus
arm_3L 17842985..17843198 22..235 100 -> Plus

BO28539.pep Sequence

Translation from 16 to 2029

> BO28539.pep
MFRFGKLHRSLSKVAKKGQTAVYSQRRCIQARSFLPGLASRTAGTPSATA
QVTGGNKQHVHPHGNSVNSGHEEHNTRWPRKVFSGIQPTGSLHLGNYLGA
VRKWVQLQNARDDVTVCIVDLHSITMPHNPPLLRENIFTMAATLLACGID
PTKSTLFVQSAVAEHAEFNWILSSLTTMPRLAQLPQFREKSRLLKDVPLG
LYVYPVLQAADIMLYKSTHVPVGADQIQHIQLAQHLARIYNGRYGETFPV
CTAIIEDGDASRVLSLRDPSKKMSKSEANPKATINLCDSPDLITQKIKKA
VTDFTSDITYNPGKRAGVSNLVNIHAQVTGQSIKTVVNEAATLDTAKYKD
RVAEAVVEHLRPIREQIHHHMTKRNEMIYLLEVGAEKARQQARQTLNDVK
QRLGLGTSANIPAAVHVAPLLPAPDISKTSASRRMSKDFDGNVHERHERM
YGFGDQPSGGAGQSATGEVADMPQAVVPRVIRRAPIVPTQSMRVEKQLGS
TRTRHVFQMDTCNAPHIGFKPPPGFSASMVTGALAKNKRATVKPVTGNLG
FGQQSQGGSYKHSQNVNPSAVSTIAREVNAAKKQEFTCNPALYGSALESL
SNSSRSSEKTNSTAGDSEFIIVASEEEEQAASSEEQREEAEEEESGERER
EKGERNATEATKVEIASFLDH

BO28539.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-PB 665 CG7441-PB 1..665 1..665 3411 100 Plus
CG7441-PA 665 CG7441-PA 1..665 1..665 3411 100 Plus