Clone BO28540 Report

Search the DGRC for BO28540

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:40
Vector:pDNR-Dual
Associated Gene/Transcriptupd3-RB
Protein status:BO28540.pep: Imported from assembly
Sequenced Size:1237

Clone Sequence Records

BO28540.complete Sequence

1237 bp assembled on 2011-07-13

GenBank Submission: KX795933

> BO28540.complete
GAAGTTATCAGTCGACATGACGACAGCTGACCGCCCGCTCGACGTCAGCA
GGAGCAGCGGAAGCGGTAGCCGGAGCGGTAACAAAACGGCCAGAACCAGG
AATCCAGTGGAACCGCAGCCGCAACCGCCGTTCGTGGATCGACGACGACG
CCTGAACAGGAACTGGTCACTGATCTTACTCGCCTTGGCCATGTCCCAGT
TTGCCCTCTCCGGCGGCGGTTGTGGCGTCTCAGCGGCGCCCAGTCACCTG
GCCACCCCGCCCACTGACAGCCCCTCCAGTCCCATCAATCCCACCAATCC
CCTGAAGCACCTACAGAAGCGTTCCAGAGCGGCCAACTTCCGGCTGACCT
TCCAGCAGAAATTGAATGCCAGCAGTACGCATCTGGACTGGGAGAACACC
TGCAATCTGAAGCCCACGGGTCTGAACGAAACGCATAGCAAGGCGAAACG
CTGCAAGAAACGCCAAAGGATCCTGCAGAATCTACAGAACCAAACGGGCC
GCGAGCTGCGGGGCATCCAGGCCGAGGACAAGGCCAGGATCACCACCAAT
GCGGACAAGCTGGCCACAGTGAGCACCAAGACTCTGGACATTGTCGAGAA
GAACAAGTGGCGATTCTATAAGGGAAACTACAGATTCCTGCCCCGTCTGA
ATCTCACTAGCAAACAGTTGAACCTTCGCCACGCCCATCGCGACCTGCAG
ATTTACGTGGGCGCCTTCACGTACATGCGCAACATCAAGTTGCATTGGGA
CCTGGCCAACTTGCAGGCGAAGAGCGTGCTCTCCGACGAGCTGGGAAGGA
TGCGGAAGTCCGCCCGCGAGGTGCTCTGCAGCGTGGAGGAGGCCATCAAC
CTGACCAACCTGCTGTACACACCCAACAGGCAGCGGGCGCCACAGCCGAG
GGGCCAGAAGAAGCGGCGCCAGGCCCAACCGGTGGTCACCTACAAGATAC
TGCCGCGCAAGCTGATGGAGAAGCGTCTGCAGCAGTTCAACTCGACGTTG
GTGCCACTCGTGGAGCTGCACCAGCAGGCGACCTTGGCCGCACGCGGGGA
GGATGTACCACCACCGCCCGACGACCTGATGGTCCTGGAGCAGCACGCCC
TCTTCACCAAACTGAAGTTTGTGCAGTATCTCAAGAGTATCCGCAAGATA
CTCGCGAACCAGCGTAAGAGTCTGTGCAAGGCGACCACCCACGTGCCAAA
GGCGATCCAGAAGAAACTCGCAAGCTTTCTAGACCAT

BO28540.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-RB 1206 CG33542-PB 1..1203 17..1219 5970 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-RB 2221 CG33542-RB 371..1573 17..1219 5970 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18283394..18283948 665..1219 2745 99.6 Plus
X 23542271 X 18279433..18279883 19..469 2240 99.8 Plus
X 23542271 X 18279985..18280187 469..671 1000 99.5 Plus
Blast to na_te.dros performed on 2014-11-26 16:50:06 has no hits.

BO28540.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:10 Download gff for BO28540.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 371..1573 17..1221 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:54 Download gff for BO28540.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 371..1573 17..1221 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:28:28 Download gff for BO28540.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 371..1573 17..1221 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:28:28 Download gff for BO28540.complete
Subject Subject Range Query Range Percent Splice Strand
X 18283397..18283948 668..1221 99   Plus
X 18279986..18280183 470..667 100 -> Plus
X 18279432..18279883 17..469 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:54 Download gff for BO28540.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18177430..18177981 668..1221 99   Plus
arm_X 18174019..18174216 470..667 100 -> Plus
arm_X 18173465..18173916 17..469 99 -> Plus

BO28540.pep Sequence

Translation from 16 to 1237

> BO28540.pep
MTTADRPLDVSRSSGSGSRSGNKTARTRNPVEPQPQPPFVDRRRRLNRNW
SLILLALAMSQFALSGGGCGVSAAPSHLATPPTDSPSSPINPTNPLKHLQ
KRSRAANFRLTFQQKLNASSTHLDWENTCNLKPTGLNETHSKAKRCKKRQ
RILQNLQNQTGRELRGIQAEDKARITTNADKLATVSTKTLDIVEKNKWRF
YKGNYRFLPRLNLTSKQLNLRHAHRDLQIYVGAFTYMRNIKLHWDLANLQ
AKSVLSDELGRMRKSAREVLCSVEEAINLTNLLYTPNRQRAPQPRGQKKR
RQAQPVVTYKILPRKLMEKRLQQFNSTLVPLVELHQQATLAARGEDVPPP
PDDLMVLEQHALFTKLKFVQYLKSIRKILANQRKSLCKATTHVPKAIQKK
LASFLDH

BO28540.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-PB 401 CG33542-PB 1..401 1..401 2070 100 Plus
os-PC 413 CG5993-PC 24..246 57..306 187 27.6 Plus
os-PB 413 CG5993-PB 24..246 57..306 187 27.6 Plus
os-PA 413 CG5993-PA 24..246 57..306 187 27.6 Plus