Clone BO28541 Report

Search the DGRC for BO28541

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptCG12182-RA
Protein status:BO28541.pep: Imported from assembly
Sequenced Size:2116

Clone Sequence Records

BO28541.complete Sequence

2116 bp assembled on 2011-08-04

GenBank Submission: KX798023

> BO28541.complete
GAAGTTATCAGTCGACATGACGAAAGTTACTGAGGGAGAAATTTCACATG
GCGTTCAAGATGTCGGGAAATATTATCTGGATTTTCACCTTCTAGCCAAA
GGATTCGTCCGCCAGGACTCGGTACACGACTTTGTAAACAGCGATTCCGA
TGGAGACTTTATAGCACTGAGCGGCTCCAAATCGGAAGTGATCACTCTGG
AATTGAGCAGCAAGTTCATGGTCGTGGATCCCTTTCCGTATTTTGTGGCC
ATTTATGATTCCAACGCTGCGGAAACACGACCTCTGGACGTTTTGGCCAA
CAAAGTGGATCTGGTTGCCATATACGACAGCTGCGATGTCCTGGAGGCAC
AGCACTTGGCCCTGGACCCGGCATACACGGCTGTGTGCTCCGTTGCCGTG
CCACCAGCCAGACTAACAGCTGTTAAGCGAGCACCCAAGCTGGCAGCTAA
TGGAAATCTCCTCCTGGGCTCCCTCAACACTTATGGATCCTTGAGCCTAA
TAAACAAGTCCGCTGAGTACAATCGTTGGAACCCTGTGGAAGGACTAAAT
ATCGCTGAAACTCTGAGGGACACTCTGCTGCCTGAAGTGGACATCGCCAA
GATAAAAGACTTTAAGAGCTATCAAGAATATATTAATCCCGCCTGGATCA
CTATGTTTGCTTGGTTACCTGATGATGCAGATGCCACTGGCCAGCATGTT
TTGGTTCTGGGAACAGCCGCAGGAAGTTTGTGGTTGCTCACACTAAGCGC
CGATGTCAAAACTCTTTTAAGTCATCAAGAAACGAAAACCTCAATGGGTC
GTATCTGCCATATACAAGCTTTCAAGGACCTTCTACTGGTGGGCGATAGC
AACGGACTCATTCACCTGTACCAATTGCCAGCTAAGGGAAATACAGCTCT
CGCCTTAGTGAAGCCCTTGTGGGAGAAAGCCGATCGCATGGGTCTGCAAA
TGGCAGTGATCACTGAATGTCCCAGAATGGATTGCTATTATATAACCTGC
TGCAAGGCGGCGCACCTGCTGACCTGGAGCATGCCAAGAACGGGGAGCAC
AGACTGCCTGCAAGCTCGGATCTATGTCGGCGGAATGAAGATCACCGCTC
TCTGCAGCCTGGAGAACAGTAGCTACGTTGCAGGAACCGCTGGAAGCTGT
TTGTCTTGCGTACAAATTATCCACGAGAATAATCAGCTTAGCCTGCAGAT
GCAATCGATAGCCATGGGTGTCCTTCAGGATTTCCAGGTGATGGGACTGT
GCACCAGTAGGCACAAGAACTTAATGACCCTGTTACTCTACCGCAACAAG
GAATATCTAAATGAAACTGTATCTCAAAAGAACCAGTTGGTTATGCAAGT
GCTCAAGGTGGGGAATCAGGATCCACTTGATCAGCTTGTCAGGCATCTGG
AATCCAATAAGCCCATGAATCACTATACCGATTTATTAGCTGGACTACGT
CTGCACGTTTTTGCCGAGGAGAATTGGCAAAAATTTATGGACTTTTGTCC
ATTAGATTCCATTGAATTTGCCGATACCGCCACTGAAGGTCAGCTGCAGC
AGCTGCAAATTAAATTTCATGTTCTTCAAAACGTGATTCGCCTGCAATCG
AGCCACCTCCAGCTGACAGTTCACATCCAAAAGTCCCGGGATGAACTGCA
GCTGCTCCTTGCGATGCTGAATATCACACACATAAGACTGAGGCTCCAGT
TTATTGGGTCATTAAGTAAGAGATCACCATTCCAGGAGCAGGCGATAAAA
TGTATGTTCGAGGAGGCCCACAGACTGATAAATAAACTCAATGACGACTT
CACGGAAAACCATGCCCTAGGATCCACAGCAAGGACATTCGTTGAACAAA
TGGGCAACCATATTCAGCACTTGCACGAGATGCTAGGTATACCTGTGATA
TCTAATCCCCAGAAGCAACTTCATCGATGCAGTGTGTCCTTTGTGGAGAT
CTCCCTCAGCTTGGAGCGACGCTACTGCAGCCTCTGCAACCGCCAAATCC
TATTCGAGCTGGACAATCTGCAAGAACTCTACGAGTCGGGGAGACATCTG
ACATGTCCCGTTTGCCATGGAAGCTTTGCCACGGAAATGTTTAATGCAGC
AAGCTTTCTAGACCAT

BO28541.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-RC 2085 CG12182-PC 1..2082 17..2098 10410 100 Plus
CG12182-RA 2085 CG12182-PA 1..2082 17..2098 10410 100 Plus
CG12182-RB 1884 CG12182-PB 1..1881 218..2098 9405 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-RC 3493 CG12182-RC 257..2342 13..2098 10415 100 Plus
CG12182-RA 2368 CG12182-RA 257..2342 13..2098 10415 100 Plus
CG12182-RB 2508 CG12182-RB 455..2482 71..2098 10140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2597194..2599070 1948..72 9385 100 Minus
3L 28110227 3L 2596993..2597144 2098..1947 760 100 Minus
3L 28110227 3L 2599265..2599323 71..13 280 98.3 Minus
Blast to na_te.dros performed on 2014-11-27 00:56:07 has no hits.

BO28541.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:53 Download gff for BO28541.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 223..2304 17..2100 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:08 Download gff for BO28541.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 261..2342 17..2100 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:00 Download gff for BO28541.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 261..2342 17..2100 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:00 Download gff for BO28541.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2599265..2599319 17..71 100   Minus
3L 2597194..2599070 72..1948 100 <- Minus
3L 2596991..2597142 1949..2100 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:08 Download gff for BO28541.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2599265..2599319 17..71 100   Minus
arm_3L 2597194..2599070 72..1948 100 <- Minus
arm_3L 2596991..2597142 1949..2100 98 <- Minus

BO28541.pep Sequence

Translation from 16 to 2116

> BO28541.pep
MTKVTEGEISHGVQDVGKYYLDFHLLAKGFVRQDSVHDFVNSDSDGDFIA
LSGSKSEVITLELSSKFMVVDPFPYFVAIYDSNAAETRPLDVLANKVDLV
AIYDSCDVLEAQHLALDPAYTAVCSVAVPPARLTAVKRAPKLAANGNLLL
GSLNTYGSLSLINKSAEYNRWNPVEGLNIAETLRDTLLPEVDIAKIKDFK
SYQEYINPAWITMFAWLPDDADATGQHVLVLGTAAGSLWLLTLSADVKTL
LSHQETKTSMGRICHIQAFKDLLLVGDSNGLIHLYQLPAKGNTALALVKP
LWEKADRMGLQMAVITECPRMDCYYITCCKAAHLLTWSMPRTGSTDCLQA
RIYVGGMKITALCSLENSSYVAGTAGSCLSCVQIIHENNQLSLQMQSIAM
GVLQDFQVMGLCTSRHKNLMTLLLYRNKEYLNETVSQKNQLVMQVLKVGN
QDPLDQLVRHLESNKPMNHYTDLLAGLRLHVFAEENWQKFMDFCPLDSIE
FADTATEGQLQQLQIKFHVLQNVIRLQSSHLQLTVHIQKSRDELQLLLAM
LNITHIRLRLQFIGSLSKRSPFQEQAIKCMFEEAHRLINKLNDDFTENHA
LGSTARTFVEQMGNHIQHLHEMLGIPVISNPQKQLHRCSVSFVEISLSLE
RRYCSLCNRQILFELDNLQELYESGRHLTCPVCHGSFATEMFNAASFLDH

BO28541.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-PC 694 CG12182-PC 1..694 1..694 3603 100 Plus
CG12182-PA 694 CG12182-PA 1..694 1..694 3603 100 Plus
CG12182-PB 627 CG12182-PB 1..627 68..694 3263 100 Plus