Clone BO28542 Report

Search the DGRC for BO28542

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG10639-RA
Protein status:BO28542.pep: Imported from assembly
Sequenced Size:1399

Clone Sequence Records

BO28542.complete Sequence

1399 bp assembled on 2011-07-13

GenBank Submission: KX795993

> BO28542.complete
GAAGTTATCAGTCGACATGGCTCAGGTGCGACTGCTGGTACAGGGACTTC
GGCGTAGCCTACTCAATGTGGGCGTGGCCGCGCCCAACGAATCCACAGCG
ACCCACAAAAGATCGCAGCACAGCTCGTCGAGCTGCGGAGATTATGATCT
GGTTGTCGTTGGTGGTGGCATCGTCGGCGCCGCATCTGCCCGGGAGATTG
TCCTGCGCCATCCATCCCTCAAAGTGGCTGTCCTGGAGAAGGAGTGCAAG
CTGGCAAAGCACCAGAGCGGCCACAACTCCGGCGTCATCCATGCTGGCAT
CTACTATAAGCCTGGAACCCTGAAAGCCCGCCTTTGCGTGGAGGGCATGC
ATTTGGCCTACGCTTATCTGGATGAAAAAAAGATCCCGTACAAGAAAACC
GGGAAGCTAATTGTGGCCACTGATGAGAAAGAAGTGAAGCTGCTGAAGGA
TTTGGAGAAGCGTGGCATTGCCAACAACGTACCGGATCTGCGAATGATCG
AAGGCAGCGAGATTCAGGAGATCGAACCCTACTGCCAGGGAGTGATGGCG
CTCCACAGTCCGCACACTGGTATCGTTGACTGGGGATTGGTTACCGAGCA
TTATGGTCAGGATTTCAAACAGTGCGGTGGTGATATCTACCTGGACTTCA
ATGTCAGCAAGTTTACCGAGACCAAGGAGGGCACCGACTACCCAGTGACC
ATCCATGGCGCTAAGCCCGGTCAAACGGTTCGTACCAAGAACGTATTAAC
CTGTGGCGGTTTGCAATCCGACCTGCTGGCTGAGAAGACTGGATGCCCCA
GAGACCCCCGCATCGTGCCTTTCCGTGGAGAGTATCTGCTGCTGACCAAG
GAAAAACAGCATATGGTCAAGGGTAATATTTATCCGGTGCCGGATCCACG
TTTCCCCTTCCTGGGAGTTCACTTTACGCCGCGAATGGACGGATCTATCT
GGCTGGGACCAAATGCCGTTCTGGCTCTGAAACGCGAAGGTTACACCTGG
GGTGACATTAATCTTTTCGAGCTTTTCGACGCCCTGCGCTATCCGGGCTT
CGTAAAGATGGCGAGCAAGTACATCGGTTTCGGACTCAGCGAGATGTCCA
AATCGTGGTTCATTAACCTGCAGATCAAGGCGTTGCAGAAGTACATCCCG
GATATTACGGAGTACGATATCCAGCGTGGTCCCGCTGGAGTACGTGCCCA
AGCAATGGATCTGGATGGCAATCTGGTGGACGATTTTGTTTTCGATCGCG
GACAAGGATCGGGAGCGCTAGCCAAGCGAGTGCTTCACTGCAGAAACGCC
CCATCGCCGGGCGCTACTAGTAGCTTGGCCATTGCCAAGATGATCGCAGA
CAAGATCGAGAATGAGTTCTCTATCGGCAAGGCAAGCTTTCTAGACCAT

BO28542.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-RC 1368 CG10639-PC 1..1365 17..1381 6810 99.9 Plus
CG10639-RB 1368 CG10639-PB 1..1365 17..1381 6810 99.9 Plus
CG10639-RA 1368 CG10639-PA 1..1365 17..1381 6810 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-RC 1870 CG10639-RC 336..1700 17..1381 6810 99.9 Plus
CG10639-RB 1685 CG10639-RB 151..1515 17..1381 6810 99.9 Plus
CG10639-RA 1945 CG10639-RA 411..1775 17..1381 6810 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18972602..18973460 996..138 4280 99.9 Minus
2L 23513712 2L 18972163..18972547 1381..997 1925 100 Minus
2L 23513712 2L 18973917..18974038 138..17 610 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:50:15 has no hits.

BO28542.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:11 Download gff for BO28542.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 411..1775 17..1383 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:10:58 Download gff for BO28542.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 411..1775 17..1383 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:28:32 Download gff for BO28542.complete
Subject Subject Range Query Range Percent Splice Strand
CG10639-RA 411..1775 17..1383 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:28:32 Download gff for BO28542.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18973917..18974038 17..138 100   Minus
2L 18972602..18973459 139..996 99 <- Minus
2L 18972160..18972547 997..1383 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:10:58 Download gff for BO28542.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18973917..18974038 17..138 100   Minus
arm_2L 18972602..18973459 139..996 99 <- Minus
arm_2L 18972160..18972547 997..1383 99 <- Minus

BO28542.pep Sequence

Translation from 16 to 1399

> BO28542.pep
MAQVRLLVQGLRRSLLNVGVAAPNESTATHKRSQHSSSSCGDYDLVVVGG
GIVGAASAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGIYYKPG
TLKARLCVEGMHLAYAYLDEKKIPYKKTGKLIVATDEKEVKLLKDLEKRG
IANNVPDLRMIEGSEIQEIEPYCQGVMALHSPHTGIVDWGLVTEHYGQDF
KQCGGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQ
SDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVPDPRFPFLG
VHFTPRMDGSIWLGPNAVLALKREGYTWGDINLFELFDALRYPGFVKMAS
KYIGFGLSEMSKSWFINLQIKALQKYIPDITEYDIQRGPAGVRAQAMDLD
GNLVDDFVFDRGQGSGALAKRVLHCRNAPSPGATSSLAIAKMIADKIENE
FSIGKASFLDH

BO28542.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10639-PC 455 CG10639-PC 1..455 1..455 2390 100 Plus
CG10639-PB 455 CG10639-PB 1..455 1..455 2390 100 Plus
CG10639-PA 455 CG10639-PA 1..455 1..455 2390 100 Plus