Clone BO28543 Report

Search the DGRC for BO28543

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG6234-RA
Protein status:BO28543.pep: Imported from assembly
Sequenced Size:1870

Clone Sequence Records

BO28543.complete Sequence

1870 bp assembled on 2011-08-04

GenBank Submission: KX799989

> BO28543.complete
GAAGTTATCAGTCGACATGGCCAGTATTTCTAAGAGCCGCGCCAGCAGCT
GCTCCTCCAGAAAGAGGCTGCATCTGCAACCGGGATCGCTGCTCTGCGTG
ATCGTCTTCTGCCTGCTGGCTTCGTGCTCGGCTCAGCCAATCGAGTCAAC
CTCATTGCCTGCAGAAGTGGACGATGTGGAGGGTACCACAATACTTCCCA
TCCAGTTGGAGGAGAGTTCACCAACACCAGAACCCATTATCAAGAATGAA
ACAGCTACTGCTCTTCCTGTCGTGGAACTCAAAGTAGCTGAATCTAATCC
TGTAGATCCTGTTGAGGCTACGGATAATTTTGTATCGGTTTACGGCGGAA
ATCTGGAGCAGGATATAAAGAACGACGTGAACAGCGAAGTGGAAGATGCG
CCCTCTCCGGTGGAACCAATCATCGAGGAAGTTCAAAAAGTGGCAGAAGC
TGAACTTGAAAATCATGAAATTAAGCTTGCGGTCCAAAGTGCTCGGGAGC
CCAAATCCCTGGATGCTGAAGAGGAGTCAAAGACAATCGATGAAGATCGC
TTGGAAAATCAAGATAAAGCGGAGACAGTAACGGATAACATTGCCGTTTC
CAGTGAGCAGATGGAGAGCCACATCAGACCATTACCCAACGTGACCAGTG
ACCTGGTTTCCGTGATTCTCAACGAAGACAAAGCCATCACTGAGCAACCG
ATCACCAAAACGAACCTTCTGGCTTTGGAGCAGGAGCACGAGAAATTCGA
GGAAATTGATGAAAGTACTACAGTGCCAGTTTATGAGGAGCCCAAGCACC
AAGTCACCAAGAAACAAGGCGTTGAGGACCCATCTACCGTTGAAATTCCA
CCTGAGGTATCTGACGAACAACACTTTGATCCTTCCGAGGAACCCCAGAC
TGTTCGCGACGAACGTAATCTTGAAGAGCACGACGACAACCAGAATGAGA
TAAATGAGAACATCATTGAAGGGGAGGAGGCTCCAGCCAAAACGTCAACC
ACCGCAGGTCCCTTGGTCACCGTGGAACCCACTAAATCGATTACCGAGCC
AAATGAGGAGATCGAGAAAAAGGCGGAAGCTGAGGCTAAGGCGGAAATGG
AGGAGCAAGTGGAGGTCAACACTCCTTCTGTAGACGCAACTGTGGTGGCA
GCGGATCCTGATGAAGCACAAGATGAAGTAATCGTTGCTGAAACAACAGT
AGAAGCTATCACAGAAGCTGCCAAGATTGTTGTGGAGGAGGAACCCAAGG
AAGATGTTTCAGTTCAACAGGAGCATCTAAAGGAACAAAGAGTCCAGACA
GTTTCCGAGTCCAACCGTCAAGCAAGTCCCACCGAGGAACCAATCAAAGA
AGTGATCTTTCCAAAAGGTGATGATGAATCCCCGGTAGAAGGGGATAGCT
CCGAATCGGATGAGAAACCAACTGAGAGAGCAATAGTGGATGACGACTCC
TCGGAGGAGCAAAACGAGGACGTTGTGGATGAGGGAAAGTCCTCTTCCGA
CGACAGCACCGCCACTCCGCTTGTCTCCTATCCCCCACACGATGCTGGCC
AAACCTTCGATAGCAACTCGGCTGACGAACACTCGGCCCAGCTGTCCGGA
GCCACCAACTACCGGTCCACCCTGATCATAGCCCTGTGCTCCGGCACAGC
AGTGATCTTCATCGTGGCCTCGCTGGTCATCTTCGTGGTTTCCTTCCAAC
GGCAGCACGGCACCTTGGACATTGAGATGCAGGAACAGCGTTTGGGCAAG
GATATTCAGGAAGAGGACAATGTCCAGATGAAGCTGCTCGATGTGGATCT
CTCGTCGCCCGTCATTCTGCCTATGGGCAACGAGGAGACCGATGAATGCC
TGGCAAGCTTTCTAGACCAT

BO28543.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dtg-RA 1839 CG6234-PA 1..1836 17..1852 9150 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dtg-RA 2464 CG6234-RA 302..2137 17..1852 9150 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12651208..12652583 477..1852 6850 99.9 Plus
3R 32079331 3R 12650814..12651149 141..476 1680 100 Plus
3R 32079331 3R 12648359..12648482 17..140 620 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:56:22 has no hits.

BO28543.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:54 Download gff for BO28543.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 300..2135 17..1854 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:16 Download gff for BO28543.complete
Subject Subject Range Query Range Percent Splice Strand
CG6234-RA 302..2137 17..1854 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:10 Download gff for BO28543.complete
Subject Subject Range Query Range Percent Splice Strand
Dtg-RA 302..2137 17..1854 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:10 Download gff for BO28543.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12651208..12652583 477..1854 99   Plus
3R 12650814..12651149 141..476 100 -> Plus
3R 12648359..12648482 17..140 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:16 Download gff for BO28543.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8476930..8478305 477..1854 99   Plus
arm_3R 8476536..8476871 141..476 100 -> Plus
arm_3R 8474081..8474204 17..140 100 -> Plus

BO28543.pep Sequence

Translation from 16 to 1870

> BO28543.pep
MASISKSRASSCSSRKRLHLQPGSLLCVIVFCLLASCSAQPIESTSLPAE
VDDVEGTTILPIQLEESSPTPEPIIKNETATALPVVELKVAESNPVDPVE
ATDNFVSVYGGNLEQDIKNDVNSEVEDAPSPVEPIIEEVQKVAEAELENH
EIKLAVQSAREPKSLDAEEESKTIDEDRLENQDKAETVTDNIAVSSEQME
SHIRPLPNVTSDLVSVILNEDKAITEQPITKTNLLALEQEHEKFEEIDES
TTVPVYEEPKHQVTKKQGVEDPSTVEIPPEVSDEQHFDPSEEPQTVRDER
NLEEHDDNQNEINENIIEGEEAPAKTSTTAGPLVTVEPTKSITEPNEEIE
KKAEAEAKAEMEEQVEVNTPSVDATVVAADPDEAQDEVIVAETTVEAITE
AAKIVVEEEPKEDVSVQQEHLKEQRVQTVSESNRQASPTEEPIKEVIFPK
GDDESPVEGDSSESDEKPTERAIVDDDSSEEQNEDVVDEGKSSSDDSTAT
PLVSYPPHDAGQTFDSNSADEHSAQLSGATNYRSTLIIALCSGTAVIFIV
ASLVIFVVSFQRQHGTLDIEMQEQRLGKDIQEEDNVQMKLLDVDLSSPVI
LPMGNEETDECLASFLDH

BO28543.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dtg-PA 612 CG6234-PA 1..612 1..612 3067 100 Plus
Msp300-PE 9606 CG42768-PE 4131..4571 62..496 195 22 Plus
Msp300-PG 13540 CG42768-PG 4131..4571 62..496 195 22 Plus
Strn-Mlck-PT 7905 CG44162-PT 3581..4041 63..497 194 21.7 Plus
Strn-Mlck-PV 7944 CG44162-PV 3620..4080 63..497 194 21.7 Plus
Strn-Mlck-PT 7905 CG44162-PT 4226..4691 42..497 188 21.1 Plus
Strn-Mlck-PT 7905 CG44162-PT 3383..3846 72..497 187 21.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 3493..3911 107..497 187 21.6 Plus
Msp300-PE 9606 CG42768-PE 8182..8586 65..496 182 25.3 Plus
Msp300-PG 13540 CG42768-PG 8182..8586 65..496 182 25.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 4556..5007 63..496 182 22.4 Plus
Msp300-PE 9606 CG42768-PE 4247..4672 42..496 181 23.3 Plus
Msp300-PG 13540 CG42768-PG 4247..4672 42..496 181 23.3 Plus
Strn-Mlck-PT 7905 CG44162-PT 3841..4301 63..497 174 20.3 Plus
Msp300-PE 9606 CG42768-PE 4369..4773 65..496 172 23.6 Plus
Msp300-PE 9606 CG42768-PE 5097..5488 64..458 172 22.7 Plus
Msp300-PG 13540 CG42768-PG 4369..4773 65..496 172 23.6 Plus
Msp300-PG 13540 CG42768-PG 5097..5488 64..458 172 22.7 Plus
Msp300-PE 9606 CG42768-PE 2732..3175 84..496 170 21.8 Plus
Msp300-PG 13540 CG42768-PG 2732..3175 84..496 170 21.8 Plus
Strn-Mlck-PT 7905 CG44162-PT 4751..5163 63..486 168 20.7 Plus
Msp300-PE 9606 CG42768-PE 4571..4975 65..496 165 22.9 Plus
Msp300-PG 13540 CG42768-PG 4571..4975 65..496 165 22.9 Plus
Msp300-PE 9606 CG42768-PE 3175..3541 65..459 162 25.7 Plus
Msp300-PE 9606 CG42768-PE 8283..8686 65..495 162 24.8 Plus
Msp300-PG 13540 CG42768-PG 3175..3541 65..459 162 25.7 Plus
Msp300-PG 13540 CG42768-PG 8283..8686 65..495 162 24.8 Plus