Clone BO28545 Report

Search the DGRC for BO28545

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:45
Vector:pDNR-Dual
Associated Gene/Transcriptspz-RB
Protein status:BO28545.pep: Imported from assembly
Sequenced Size:934

Clone Sequence Records

BO28545.complete Sequence

934 bp assembled on 2011-07-13

GenBank Submission: KX797359

> BO28545.complete
GAAGTTATCAGTCGACATGATGACGCCCATGTGGATATCGCTGTTCAAAG
TCCTGCTGCTGCTGTTCGCCTTCTTTGCCACGACGTCCGCGGACAGTGCA
CCCTTCATGCCCATACCCACCCAGCACGACGATCCGACCCAGAAACAGAA
ACAGAATCAGAATCAATCTCCGATACCCGAAACGAACCGCCATTACCATC
AGTATCACAGCCTGATCCAACCAGATCAGTACTTCAAAGTGCAGCGCTCC
CCGAATGGAAAGCTGAATCTGGTCTTTAACGATACGTTCGTATCTTTGCA
GAGGACGGACACGGAGGTGCAATCCGAACAGCCGATACCCCCCCGACATC
CATCGGATACCTTTGTCTTCCCCGATTCCCCCATAGCCAAGTATCGGCCA
CCACAATCCCCAGCTCGTCCTTTGAGGAATGACACTAAGGAGCACAATCC
CTGCGCCAAGGATGAAAGCCAACACCTTAGAAACTTCTGCACGAATGTGG
ACGACTATCCGGACCTTTCAGGCCTCACACATAAGCTAAAAAACAACTTC
GCCAAGTTCTTTAGCAACGATCTTCAGCCCACGGATGTGAGCTCTCGCGT
TGGTGGCTCAGATGAGCGATTCCTTTGCAGGAGCATCAGGAAGCTGGTGT
ACCCAAAAAAGGGCTTGAGGGCGGACGACACCTGGCAGTTAATTGTCAAT
AACGATGAGTACAAACAGGCCATCCAGATCGAAGAGTGCGAAGGAGCGGA
TCAACCCTGTGACTTTGCCGCCAACTTTCCGCAGAGCTATAATCCAATCT
GCAAGCAGCACTACACACAGCAGACCCTGGCCAGCATCAAGAGTGATGGC
GAACTGGACGTGGTGCAGAATTCCTTCAAGATCCCCTCCTGCTGCAAGTG
CGCGTTGAAGACTGGGGCAAGCTTTCTAGACCAT

BO28545.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
spz-RB 903 CG6134-PB 1..900 17..916 4410 99.3 Plus
spz-RA 981 CG6134-PA 145..978 83..916 4080 99.3 Plus
spz-RD 822 CG6134-PD 202..819 299..916 3000 99 Plus
spz-RA 981 CG6134-PA 1..66 17..82 330 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
spz-RB 2050 CG6134-RB 861..1761 16..916 4415 99.3 Plus
spz-RA 2128 CG6134-RA 1006..1839 83..916 4080 99.3 Plus
spz-RD 1969 CG6134-RD 1063..1680 299..916 3000 99 Plus
spz-RA 2128 CG6134-RA 861..927 16..82 335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27066099..27066480 741..360 1865 99.2 Minus
3R 32079331 3R 27066608..27066885 359..82 1390 100 Minus
3R 32079331 3R 27065857..27066031 916..742 830 98.3 Minus
3R 32079331 3R 27069144..27069210 82..16 335 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:51:56 has no hits.

BO28545.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 10:17:12 Download gff for BO28545.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 860..1759 17..918 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:11:46 Download gff for BO28545.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 862..1761 17..918 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:14 Download gff for BO28545.complete
Subject Subject Range Query Range Percent Splice Strand
spz-RB 862..1761 17..918 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:29:14 Download gff for BO28545.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27069144..27069209 17..82 100   Minus
3R 27066608..27066884 83..359 100 <- Minus
3R 27066099..27066480 360..741 99 <- Minus
3R 27065854..27066031 742..918 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:11:46 Download gff for BO28545.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22894866..22894931 17..82 100   Minus
arm_3R 22892330..22892606 83..359 100 <- Minus
arm_3R 22891821..22892202 360..741 99 <- Minus
arm_3R 22891576..22891753 742..918 97 <- Minus

BO28545.pep Sequence

Translation from 16 to 934

> BO28545.pep
MMTPMWISLFKVLLLLFAFFATTSADSAPFMPIPTQHDDPTQKQKQNQNQ
SPIPETNRHYHQYHSLIQPDQYFKVQRSPNGKLNLVFNDTFVSLQRTDTE
VQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKEHNPCAKDE
SQHLRNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDE
RFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDF
AANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG
ASFLDH

BO28545.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
spz-PB 300 CG6134-PB 1..300 1..300 1628 100 Plus
spz-PA 326 CG6134-PA 1..326 1..300 1591 92 Plus
spz-PL 270 CG6134-PL 1..270 1..300 1422 90 Plus
spz-PD 273 CG6134-PD 1..273 1..300 1189 78 Plus
spz-PC 253 CG6134-PC 1..253 1..300 1181 78.1 Plus