Clone BO28547 Report

Search the DGRC for BO28547

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG15814-RA
Protein status:BO28547.pep: Imported from assembly
Sequenced Size:997

Clone Sequence Records

BO28547.complete Sequence

997 bp assembled on 2011-07-13

GenBank Submission: KX799418

> BO28547.complete
GAAGTTATCAGTCGACATGCACCAGGAGCACATGGACCTGCATGAGCCCG
TGGACTTGAACAAGTCCCTGGACGAAATGACGCCGGAGGAGCGAATGCGA
GCGCAGCATCAACTGATGGTGGAGAAACATCGCGGCCACGATGCCATGCA
CTCCGAGATGGTGATCATTCTGTTCGTCACCCTGGTTATTGCCCAGATCA
TCCTGGTCGAGTGGAAGAAGCGGCACTACAGATCCTACGCTTTCGTCACC
CTGCTGGCCATGTGGCTCATTCCGCTGATCATCTCCTGCAGCTTCGGCTG
GCTGCGCTTCATAATCATCTGGCTGGTGTTCACCTGCATCACGGCACTGG
TTATGCGACGGGCCATCAGCAAGCCCATCCAGGGCACAACGCCTAGGCTG
GTCTACAAGTGGTTCTACTTCATCTACAAGCTCAGCTATGGCCTTGGCCT
GGTGGGCTATCTGGTGATCATAGCCGCCTTTCTGGGCATGAATTACATGT
TCTCACAGCCACCAAACACATGGATGGATGTGGGCCTGATGTTCTGCTTC
TACGGCCTGTACATCGGCGTCCTGGGGCGTGATATATCCGAGATATGTTC
GGATAAGATGGCGGCAGCTATTGGCTACTACACACCTCAGGGTATTCCAA
CACGACATCTTGATCAGAATGTCTGCGCAGTGTGTGGCAATCAGTTGCTG
GTCTCGGAGAAGGAAGAGGGCGTCATTGAGAACACCTACAAGTTGTCTTG
TAACCACGTATTCCACGAGTTCTGTATACGTGGTTGGTGCATTGTGGGCA
AGAAGCAGACGTGTCCCTACTGCAAGGAAAAGGTCGATCTCCAGAAGATG
TTCCGCAATCCCTGGGAGAAGCCGCACGTTTTGTACGGTCGCCTGCTGGA
TTGGATTCGTTGGCTGGTGGCCTGGCAGCCGCTCATCTTTTTCATAGTAC
AAGGCATCAACTGGATGCTGGGACTGGAGGCAAGCTTTCTAGACCAT

BO28547.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-RC 966 CG15814-PC 1..963 17..979 4815 100 Plus
CG15814-RA 966 CG15814-PA 1..963 17..979 4815 100 Plus
CG15814-RB 966 CG15814-PB 1..963 17..979 4815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-RC 1740 CG15814-RC 244..1206 17..979 4815 100 Plus
CG15814-RA 1884 CG15814-RA 388..1350 17..979 4815 100 Plus
CG15814-RB 1664 CG15814-RB 168..1130 17..979 4815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17849413..17849711 397..99 1495 100 Minus
X 23542271 X 17848819..17849054 861..626 1180 100 Minus
X 23542271 X 17849117..17849347 625..395 1155 100 Minus
X 23542271 X 17848644..17848761 979..862 590 100 Minus
X 23542271 X 17849908..17849955 64..17 240 100 Minus
X 23542271 X 17849776..17849812 99..63 185 100 Minus
Blast to na_te.dros performed 2014-11-26 16:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Osvaldo 1543 Osvaldo OSV 1543bp 263..299 291..255 113 78.4 Minus

BO28547.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 12:47:02 Download gff for BO28547.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RC 179..1141 17..981 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:14:22 Download gff for BO28547.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RB 168..1130 17..981 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:51 Download gff for BO28547.complete
Subject Subject Range Query Range Percent Splice Strand
CG15814-RB 168..1130 17..981 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:51 Download gff for BO28547.complete
Subject Subject Range Query Range Percent Splice Strand
X 17849908..17849955 17..64 100   Minus
X 17849776..17849810 65..99 100 <- Minus
X 17849414..17849710 100..396 100 <- Minus
X 17849117..17849345 397..625 100 <- Minus
X 17848819..17849054 626..861 100 <- Minus
X 17848642..17848761 862..981 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:14:22 Download gff for BO28547.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17743941..17743988 17..64 100   Minus
arm_X 17743809..17743843 65..99 100 <- Minus
arm_X 17743447..17743743 100..396 100 <- Minus
arm_X 17743150..17743378 397..625 100 <- Minus
arm_X 17742852..17743087 626..861 100 <- Minus
arm_X 17742675..17742794 862..981 98 <- Minus

BO28547.pep Sequence

Translation from 16 to 997

> BO28547.pep
MHQEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDAMHSEMVI
ILFVTLVIAQIILVEWKKRHYRSYAFVTLLAMWLIPLIISCSFGWLRFII
IWLVFTCITALVMRRAISKPIQGTTPRLVYKWFYFIYKLSYGLGLVGYLV
IIAAFLGMNYMFSQPPNTWMDVGLMFCFYGLYIGVLGRDISEICSDKMAA
AIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENTYKLSCNHVFH
EFCIRGWCIVGKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWL
VAWQPLIFFIVQGINWMLGLEASFLDH

BO28547.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15814-PC 321 CG15814-PC 1..321 1..321 1754 100 Plus
CG15814-PA 321 CG15814-PA 1..321 1..321 1754 100 Plus
CG15814-PB 321 CG15814-PB 1..321 1..321 1754 100 Plus
CG15814-PD 301 CG15814-PD 1..301 21..321 1644 100 Plus