Clone BO28549 Report

Search the DGRC for BO28549

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG8726-RB
Protein status:BO28549.pep: Imported from assembly
Sequenced Size:1972

Clone Sequence Records

BO28549.complete Sequence

1972 bp assembled on 2011-08-04

GenBank Submission: KX796002

> BO28549.complete
GAAGTTATCAGTCGACATGGCCGTTTTTGCGAGCAGATATGAACGGAAAT
TGCCAATTGACGACACCCAGGCGCTGAGCTGCGAGATAACCGCCGTCCAG
GAGGTCGCCGGACATACGGAGTACCTGCTGCGCGTGTGGAGGGGCGCCAG
CAACAAGAACTACTGGACCGTTTTGCGCCGCTATAATGACTTCGACCGAC
TGGACAAGTCTCTCCGCGTCTCCGGCATCGAGCTGCCGCTGCCTCGCAAA
CGCATCTTTGGTAACATGCGCCCGGAGTTCATAGCTGAACGGAAGCAAGC
CCTGCAAGAGTACATAAACGCCGTACTAATGAATCCCATATTGGCATCCT
CGCTGCCAGCCAAGCGCTTTGTGGATCCCGAGAGTTACTCGCAGTCCTTT
CACGACCATGCCGTGCAGAATGCTATGCTCTGCCTGCGCAACGACACTAC
GTGGTCGCTGGGTGGAAGTATGGGTGCCATAGGCTGGCGCCTCCGGAAGC
ACTACTTTAAGGTCACTACAAAGCCGCCGGAGAAGAGCAGCAACAAGCAA
CTGGTTAAGAGCGGTTCACAGACCCATCAGAGCAAACATTTCGCCGCTGG
GAGCAGCAATGGCAGCGGTCACTCCATCGACGCCGGAACCTTGGATCCCG
GGTCAGAGGTGGTGGCTGAGTGGCTGGAGTACGGACCCGACAAGTTTATC
GACGAAAAAGAAATCGGGGGCATAATGAAAAGCCTGATGGGCCTGCAGCA
TCCGCACATCGAGCCCGTTCTCCTGGCAGCCCACACCGAAAACGGTTGCC
TGGTCATAAGAAAATTCCACAAGCATGGTACTTTAAAGGATGTTTTGTGC
ATGGCCGCGAATCCAAAGAATACATTTCTTAGCAAGTACGGCAATCCCAA
GGGGCGCACTGCGCTTTCAATGAAACAAGTGGCTACATATGGGAAGCAGA
TTCTAGAGGCCCTAATATTTTTGCACTCGAAGGGATACGCATATGGTCAT
CTACATTCCGGAAACATAGTGATAGTCGACGATTGTGTTAAGCTACTGGA
CATCGAGAACTTTTTGCTGGGCGTTCCAGCGTTTTACCGGCCATTTTTCA
TGCAGCACAGTAAAATCCATGCCATCGAGACCATTGATGTTTACTGTTTT
GGTCATGTCCTCTTCGAAATGGCCATGGGTTATCCTCTGCAGGAGTCTGT
CGTGCGCCAGATCACCGAATGTCCCGAAGCGCTGAAATGTCTTCTGGAGA
GCATTCTTTCCAAGGAAGCTTGCAAAGCTGGCCTGCCGACTCTGGAGCAA
TTGTTGGGTCACAGATTCTTCTTGCAATACGCTTCAACCGAGAGCGCCGG
CGCCGCTGCCAATGCTGAAAAGCCGTACTTTAAGCTATCATTGAACGCCA
AGGAGCTGCTTAAGCAGGCGGCTATCAAGAGCGAAAACCGCCTGCGGGAC
GAACAGAAGTCTGTGAAGAACCAAAAGCGCATTGTGCGTGTCCAGGAACT
GATGAGCTCCGAGGAGGAGAAGCGGAAGTCCAAGCAGAAAGCCAAACTAG
AGCACAAACAGTCGAAGCTAAAGCAGCAAAGTTCAATCCAAACAAACAAT
GGACGCTTGTCGCTTGTGGCTGCGACTGCAGCAGCAGCTTCCTCAAGCAC
CACGGTGGTTGGCGAGTTATGTGGGACCGACTCCTTCAACCGCTCCGACA
GCACACCCGAGGAGCCCACCACACTGGCCGGCATCAAATCACCGCCGCTC
ACTCCGGGGCCACACTTGGGCAGCATATATCAGCAGGAATTGCCGTCGAC
GACTGGCGCACCGGTGGAACGGCAGTCCTCCACACCGAACATGCTGTCTG
AGGATGCGGAGGGCGGTGATGGCGACGAGCCAACACGCTCCGCTCTTCTG
GAGTCCATCTGCAAGTTTAACCGCGGATCGCTGCGCAAAGTGCGATCCAA
CGACGCAAGCTTTCTAGACCAT

BO28549.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-RB 1941 CG8726-PB 1..1938 17..1954 9690 100 Plus
CG8726-RA 1692 CG8726-PA 1..1689 266..1954 8445 100 Plus
CG8726-RC 1323 CG8726-PC 1..1278 266..1543 6390 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-RB 3336 CG8726-RB 266..2203 17..1954 9690 100 Plus
CG8726-RA 3371 CG8726-RA 402..2238 118..1954 9185 100 Plus
CG8726-RC 3470 CG8726-RC 402..1827 118..1543 7130 100 Plus
CG8726-RA 3371 CG8726-RA 266..368 17..119 515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7970774..7971183 813..404 2050 100 Minus
2R 25286936 2R 7969869..7970176 1543..1236 1540 100 Minus
2R 25286936 2R 7971244..7971530 404..118 1435 100 Minus
2R 25286936 2R 7970235..7970475 1235..995 1205 100 Minus
2R 25286936 2R 7969262..7969476 1954..1740 1075 100 Minus
2R 25286936 2R 7969574..7969769 1739..1544 980 100 Minus
2R 25286936 2R 7970530..7970713 997..814 920 100 Minus
2R 25286936 2R 7971636..7971738 119..17 515 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:57:18 has no hits.

BO28549.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:55 Download gff for BO28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 312..2249 17..1956 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:48 Download gff for BO28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 266..2203 17..1956 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:37 Download gff for BO28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG8726-RB 266..2203 17..1956 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:37 Download gff for BO28549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7971637..7971738 17..118 100   Minus
2R 7971244..7971529 119..404 100 <- Minus
2R 7970774..7971182 405..813 100 <- Minus
2R 7970532..7970713 814..995 100 <- Minus
2R 7970235..7970474 996..1235 100 <- Minus
2R 7969869..7970176 1236..1543 100 <- Minus
2R 7969574..7969769 1544..1739 100 <- Minus
2R 7969258..7969476 1740..1956 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:48 Download gff for BO28549.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3859142..3859243 17..118 100   Minus
arm_2R 3858749..3859034 119..404 100 <- Minus
arm_2R 3858279..3858687 405..813 100 <- Minus
arm_2R 3858037..3858218 814..995 100 <- Minus
arm_2R 3857740..3857979 996..1235 100 <- Minus
arm_2R 3857374..3857681 1236..1543 100 <- Minus
arm_2R 3857079..3857274 1544..1739 100 <- Minus
arm_2R 3856763..3856981 1740..1956 99 <- Minus

BO28549.pep Sequence

Translation from 16 to 1972

> BO28549.pep
MAVFASRYERKLPIDDTQALSCEITAVQEVAGHTEYLLRVWRGASNKNYW
TVLRRYNDFDRLDKSLRVSGIELPLPRKRIFGNMRPEFIAERKQALQEYI
NAVLMNPILASSLPAKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGG
SMGAIGWRLRKHYFKVTTKPPEKSSNKQLVKSGSQTHQSKHFAAGSSNGS
GHSIDAGTLDPGSEVVAEWLEYGPDKFIDEKEIGGIMKSLMGLQHPHIEP
VLLAAHTENGCLVIRKFHKHGTLKDVLCMAANPKNTFLSKYGNPKGRTAL
SMKQVATYGKQILEALIFLHSKGYAYGHLHSGNIVIVDDCVKLLDIENFL
LGVPAFYRPFFMQHSKIHAIETIDVYCFGHVLFEMAMGYPLQESVVRQIT
ECPEALKCLLESILSKEACKAGLPTLEQLLGHRFFLQYASTESAGAAANA
EKPYFKLSLNAKELLKQAAIKSENRLRDEQKSVKNQKRIVRVQELMSSEE
EKRKSKQKAKLEHKQSKLKQQSSIQTNNGRLSLVAATAAAASSSTTVVGE
LCGTDSFNRSDSTPEEPTTLAGIKSPPLTPGPHLGSIYQQELPSTTGAPV
ERQSSTPNMLSEDAEGGDGDEPTRSALLESICKFNRGSLRKVRSNDASFL
DH

BO28549.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8726-PB 646 CG8726-PB 1..646 1..646 3340 100 Plus
CG8726-PA 563 CG8726-PA 1..563 84..646 2906 100 Plus
CG8726-PC 440 CG8726-PC 1..426 84..509 2212 100 Plus
Slob-PG 459 CG43756-PG 175..433 236..482 240 30.7 Plus
Slob-PA 515 CG43756-PA 231..489 236..482 240 30.7 Plus