Clone BO28552 Report

Search the DGRC for BO28552

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:52
Vector:pDNR-Dual
Associated Gene/Transcripttbce-RB
Protein status:BO28552.pep: Imported from assembly
Sequenced Size:1603

Clone Sequence Records

BO28552.complete Sequence

1603 bp assembled on 2011-07-13

GenBank Submission: KX796073

> BO28552.complete
GAAGTTATCAGTCGACATGGTGGGAATTATCGATGAGGTGCAGCTTTTTT
ATCCCCTAGGAACCCGCATCAAAATTGGGGACAACTACGGCACAGTGCGT
TATGTGGGAGAGGTGAGCGGCCATATGGGTAGCTGGCTGGGAATAGAATG
GGACGACGGACTGCGTGGCAAACACAACGGCATCGTGGACGGCAAGCGCT
ACTTTCAGACGCAGACACCCACGGGAGGCAGCTTCATCCGACCGGGAAAG
GTAGGGCCTTGTGCCACCCTGGAGGACGCTGCTCGGGAGCGGTACCTAAA
CTACGACTCGAGCAACGTCGACGAGTCTCTTATCCGGGAAGCTCAGGCCA
GCCTGCAGGCGTCGCTTTTTGAAGTCGTGGGCATGGACAAGATCGCTCGC
AAGCAAAGCAAGTTCGAGCAACTGGAGGAGGTGAGTGTAGACCAGACGCC
GGTAAACGCTGCCGGTTACCTGAAGGAGTTGACACACCTCACAACGTTGA
ACGTAAGCCATACCTTAATCTGGAATTGGGAGATCGTGGCCAGTATAGCG
CAACAGCTACCCTCCTTAACCAACCTGAACCTGAGCTCCAACCGATTGGT
CCTGCCCACGTCATCCCAAATCACTGAGCTTGAGCCCTCATTTCGGCAGC
TCAAACGCATCAACCTTCGCAGTTGTGGCTTTTCCGACTGGAAGGATGTA
ATGCACACAGCGCTTCTCTGGCCAAATATTTTGTCACTGGGCTTACAGGA
GAATTCACTCGGCCAGCTAGCAGAAGTCGATCGAACAAAGATATTTAAGC
AGCTACATGAACTCGACTTACACCGCACGAACATTATGGATTTTGACCAG
GTGACAAAGTTGGGCAACCTCACGACTTTGCGCTTACTGAATATCATGGA
GAATGGTATCGAGGAGATAAAACTTCCCGACTGTGATTCACAAGAAAAGC
TTAATATTTTTGTCTCGCTGGAGCAGCTGAACCTGCTTCACAATCCCATT
TGGAATGAGGCTGATGCGTTTAACGAGCTGGACAAGCTGCCACAGCTGAA
ACGCCTGAGTAAGACTCCGCACTTAAAGTCAAACTTTGATGAAATGTTCT
CCAAAGCTGTAGCTAGCATAGCCAGCCTGCAGTTCATTAATAAAGCCGAG
GTGACAGCGGAACAGAGACGTGGAGCCGAGTACGATATTTGGAAAAAGTA
TGCTCTAGATTGGATGCAGGCGACGCAAGGGGGGACAGATTCCTTACGGG
AGTTTTGCCGAAGACATCGCACCTACCCCCTGCTGGTTAAAAAGTACGGT
TCCCCGGCAGACTTTGTACCGCGTAGTCAAGCGAAGCAGTCGAATTTGAT
TAATGTTTCCATAAGACATCAGCTGACGGGCGAAACCTGGGAGAAGAAAG
TCCCGCGAATGATTACTGTGCAGACGCTGCAGGGATTGGTTATGAAGCGA
TTCCGGTTAAGCGGTGACGTCCCGCAGCTTTGCTACGTTGATGCGTTGCA
TCCGGATCTTGTGGTACCATTGGATAACAATGCTAAAACACTGGACTTTT
ATTCTGTACAGGAGCATGATACAGTTTTGGTTCAAGCAAGCTTTCTAGAC
CAT

BO28552.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Tbce-RC 1572 CG7861-PC 1..1569 17..1585 7815 99.9 Plus
Tbce-RB 1572 CG7861-PB 1..1569 17..1585 7815 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Tbce-RC 2144 CG7861-RC 338..1906 17..1585 7815 99.9 Plus
Tbce-RB 2080 CG7861-RB 274..1842 17..1585 7815 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6043091..6043565 111..585 2345 99.6 Plus
2R 25286936 2R 6043613..6044039 584..1010 2135 100 Plus
2R 25286936 2R 6044434..6044726 1293..1585 1465 100 Plus
2R 25286936 2R 6044094..6044378 1008..1292 1425 100 Plus
2R 25286936 2R 6042928..6043029 17..118 510 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:33:46 has no hits.

BO28552.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-13 13:04:22 Download gff for BO28552.complete
Subject Subject Range Query Range Percent Splice Strand
tbce-RB 274..1842 17..1587 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:11 Download gff for BO28552.complete
Subject Subject Range Query Range Percent Splice Strand
tbce-RB 274..1842 17..1587 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:28 Download gff for BO28552.complete
Subject Subject Range Query Range Percent Splice Strand
Tbce-RB 274..1842 17..1587 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:28 Download gff for BO28552.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6044434..6044726 1293..1587 99   Plus
2R 6044096..6044378 1010..1292 100 -> Plus
2R 6043615..6044038 586..1009 100 -> Plus
2R 6043093..6043565 113..585 99 -> Plus
2R 6042928..6043023 17..112 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:11 Download gff for BO28552.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1931939..1932231 1293..1587 99   Plus
arm_2R 1931601..1931883 1010..1292 100 -> Plus
arm_2R 1931120..1931543 586..1009 100 -> Plus
arm_2R 1930598..1931070 113..585 99 -> Plus
arm_2R 1930433..1930528 17..112 100 -> Plus

BO28552.pep Sequence

Translation from 16 to 1603

> BO28552.pep
MVGIIDEVQLFYPLGTRIKIGDNYGTVRYVGEVSGHMGSWLGIEWDDGLR
GKHNGIVDGKRYFQTQTPTGGSFIRPGKVGPCATLEDAARERYLNYDSSN
VDESLIREAQASLQASLFEVVGMDKIARKQSKFEQLEEVSVDQTPVNAAG
YLKELTHLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLSSNRLVLPTSS
QITELEPSFRQLKRINLRSCGFSDWKDVMHTALLWPNILSLGLQENSLGQ
LAEVDRTKIFKQLHELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIEE
IKLPDCDSQEKLNIFVSLEQLNLLHNPIWNEADAFNELDKLPQLKRLSKT
PHLKSNFDEMFSKAVASIASLQFINKAEVTAEQRRGAEYDIWKKYALDWM
QATQGGTDSLREFCRRHRTYPLLVKKYGSPADFVPRSQAKQSNLINVSIR
HQLTGETWEKKVPRMITVQTLQGLVMKRFRLSGDVPQLCYVDALHPDLVV
PLDNNAKTLDFYSVQEHDTVLVQASFLDH

BO28552.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Tbce-PC 523 CG7861-PC 1..523 1..523 2715 100 Plus
Tbce-PB 523 CG7861-PB 1..523 1..523 2715 100 Plus