Clone BO28553 Report

Search the DGRC for BO28553

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:53
Vector:pDNR-Dual
Associated Gene/Transcriptdefl-RA
Protein status:BO28553.pep: Imported from assembly
Sequenced Size:3037

Clone Sequence Records

BO28553.complete Sequence

3037 bp assembled on 2011-08-04

GenBank Submission: KX796950

> BO28553.complete
GAAGTTATCAGTCGACATGTCTCACCTGACCGGCACCCGCGTGAGCACCT
TCAACGAGAGCTTCCTTAACGAAAATGAGCACGACTCGAATGCGGTGCTC
ATGGAACTGGACAAGGGACTGCGGAGCACCAAGCAGGGAATCCAGTGCGA
GGCGGTCGTCCGCTTTCCGCGCCTCTTCGAGAAGTATCCGTTTCCCATTC
TCATCAACTCGTCGTTCATTAAGCTGGCCGATTACTTTGTCAGCGGATCG
AATCTGCTGCGCTTCTGGGTGCTCCGTGTTTGCCAGCAGAGCGAGAATCA
TCTGGACAAGATCCTCAACATTGACAGCTTTGTGCGCTGTATCTTTGTGG
TGATGCACTCCAACGATCCGGTGGCGCGTGCTCTCCTCCTGCGCACCTTG
GGCGCCGTTTCCCGTGTGATTCCCGAGAAGCAACAGGTTCATCATGCCAT
TCGACGTGCTCTGGATAGCCACGATACCGTCGAGGTGGAGGCTGCCATCT
ATGCCAGCAGCTGCTTTGCCGCCCAGTCAAGTTCCTTTGCCATCAGCATG
TGCGCCAAGATTTCGGACATGATCGAATCGCTTCAGGTGCCGGTGCCAAT
GAAGCTGCTCCTGATTCCCGTGTTGCGACACATGCATCACGAGGCTACCA
CAGCGTCACTGGTTAGCAGACTGTGCATGGATCTGCTGCCCAAATATCCA
GCCCAGAGCTTTGTGGTGGCCATCATAGACACGCTCACTCAATTGTCATC
ACGAACGCTGGTGGGAGTGCCCGGTCAGCTGGATGTTCTGCTGGATTTCA
TGCAGGACTTAAGGACACCAGTACGCATACAGGTGCTGCGATCTTTCAAC
GAGTTGGCCGGACGTCAGAGCGTTCATGCCTGGCCCAAGCCAGCCATCAA
AGCGCTCATTGATCGTTTTGAATTGTGTACCAATTCCAAGGAGCAGTTCC
TCTTCCTCTCAATCCTGCTGAAGTTAAGCGAGTGCCCGCTTACTTGCCAG
CAGCTGCTTCGCGAGCATCGCGTAGCCCTGCTCCGTTTGTGCATCCAGTG
CATTAGCAAGCTGGACGACTACACCACCGCCACTCAGGCCATGGCAGTTT
TGTCGGTTCTAGTAGCATTTGGTTTAAAAAAAAAGGGCAGCGGCGAGCAG
GTGGACGATATTCTTCATATGGTCAACCTGCACATGGAAGGATTGCTCCT
TTGCACGGCCAAGCGGTCGGAGTGCACCCGCGATCTCCGTAGGGTGCTGA
CATACGGTATAAGGATCACTAAAGCCAACGCTGAATTTGGAACATCCTTC
ATTGGGATCGTGACCAATAGCCTGGGAGATAAGGGTGCCTATCCGCCAGC
CAATGCGGAACTTATGTGCGAGGCACTGGCGGGTCTGTGTGAGCACTTTC
AGCTGCGTAAGTACGCCTTTTCCACCGCAGAAGATTTGATAGTAGACGAA
AACGCGATGGACACCGATGAGTTGCCCCCGCCCAAGATAAATCCCATGCT
AGCTCGTTTGCCGCTCATTCTGCACAAGCTGAACACCATTATCGACCAGG
AGAATTGCGATCAACAGTTGCGCAGCGTGGAGATCCTGAGTTCTCTGGTT
CTACAAACCACCATGGGCTGTTACCTGCCGCAAAAGGTTGTTCAGTGCTT
TGAGAAATGCCTCGGTAGGCTTAACTGCTGGACGCTGTATAGGATTGCAC
GCACTGCTAGTCGCTATGGTCACCACTATGTGGCTGCTCACATTTACACC
AAGGTCTCCCAGATTGTGATCAGCGATCATATGCACTATTTCCTGGTGGC
ACTGTCGCAGATCTCGCAGGCGGAGTGCATTCTTAACTATGGCTTGGAAT
ACGCCTACATGCGGGACAATTATGCACCAAAGGTGGCACCGGAACCTCTA
ATTCCGCTGATGAAGCGCTTGGAAATGGCTAGTAATCTCTATCAGCAAGC
GCTGGCCAGCCTGCGAGCTGGCTCCTCGCCCCAGCATCCGTGCACCTTTC
AGTTGGAGTATCTGAAGATAAGGGCGCAGTTTCTGCAGACCCTTCACCTG
GCTGTGACCGTAAAGAATGCCCAGGTGATTGTGCCGCCACCGGCAATAGC
TGGAAGTTTGGCCCAGAACTCGCGCGACTATCTGCAAAAGTTTGGTCATG
TCACGAACCAGCTGCGCAAGCTGGTGAAGGCACTAAAGGCCTGCGAGGAG
ACTTACGCTAGGCTATACAAATCCTCTTTCGATGCGGATCACGTGACGCT
GGAGTTTCTGGAGGTGGCTGAATTTCAGTGCGCTCTTTTCGCCCACATCA
TCGAGTCGATTTGCTACGCCACGCCTCCGGAACCGCCTGTATTTCTAACC
ACAGGCGATCACCCGGAGACGCGCTACTTTGCCGCAAGCTGCCAGCGCAT
GGAGCAGATGCAAAAAAACCTGCCACAGGAGCCGGCCAATGCCAAGACCA
TTAGTAACCGACATTTGGATGTCATCATTGCGCAGATCGAGATCATAACA
AAGACACCGCTCTGCCTGCCGCGTTACTTCTTCCAGATTCTGCAGTCCAC
ACAGATCAAGCTATCGGTGAGTCCGCAGCCAAGGAGCGCCACCGAACCCG
TGAATGTCCAGTCGGGCAGTAATCTGGTTATCAAGGTCGAGGGTGTCCTG
CAGCACTTTAGCAAGCAGAAGAAACACTTCCGTCGCGTGGAGTCCGTTCA
ATTAAGCCTCACCTCACAGCTAATCACGCCGCCACCGCGATCCTCGCAAG
AGCTGCCCAAGCAGGGCGCCAACGATACTGTGACCCTCAATCAGATTGTA
AAGCCCCAGCGCGATTTCCTCTCCGGCAGCTTCCTGTTGCCCATCTCCAA
TGGCGGGCACTTCCAGGTGACGCTGGAAACATTCGTGGTGGACGAGAATG
GCATTACCTGGTGCACTGGCCCCAAATCCTCGATGGTGGTGCGGGTGCTG
GAGGATCCTAGCAAGCAGGGCGCTCCAGCGCCGAGCACTTCCCAGGCAGT
GGGACAGACGAGGAGGTTTGCAAGCTTTCTAGACCAT

BO28553.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
defl-RA 3006 CG18176-PA 1..3003 17..3019 15015 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
defl-RA 3227 CG18176-RA 119..3122 16..3019 15020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9725067..9726601 1485..3019 7675 100 Plus
3L 28110227 3L 9723541..9725011 16..1486 7355 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:57:32 has no hits.

BO28553.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:56 Download gff for BO28553.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 116..3118 17..3021 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:57 Download gff for BO28553.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 120..3122 17..3021 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:42 Download gff for BO28553.complete
Subject Subject Range Query Range Percent Splice Strand
defl-RA 120..3122 17..3021 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:42 Download gff for BO28553.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9725069..9726601 1487..3021 99   Plus
3L 9723542..9725011 17..1486 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:57 Download gff for BO28553.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9718169..9719701 1487..3021 99   Plus
arm_3L 9716642..9718111 17..1486 100 -> Plus

BO28553.pep Sequence

Translation from 16 to 3037

> BO28553.pep
MSHLTGTRVSTFNESFLNENEHDSNAVLMELDKGLRSTKQGIQCEAVVRF
PRLFEKYPFPILINSSFIKLADYFVSGSNLLRFWVLRVCQQSENHLDKIL
NIDSFVRCIFVVMHSNDPVARALLLRTLGAVSRVIPEKQQVHHAIRRALD
SHDTVEVEAAIYASSCFAAQSSSFAISMCAKISDMIESLQVPVPMKLLLI
PVLRHMHHEATTASLVSRLCMDLLPKYPAQSFVVAIIDTLTQLSSRTLVG
VPGQLDVLLDFMQDLRTPVRIQVLRSFNELAGRQSVHAWPKPAIKALIDR
FELCTNSKEQFLFLSILLKLSECPLTCQQLLREHRVALLRLCIQCISKLD
DYTTATQAMAVLSVLVAFGLKKKGSGEQVDDILHMVNLHMEGLLLCTAKR
SECTRDLRRVLTYGIRITKANAEFGTSFIGIVTNSLGDKGAYPPANAELM
CEALAGLCEHFQLRKYAFSTAEDLIVDENAMDTDELPPPKINPMLARLPL
ILHKLNTIIDQENCDQQLRSVEILSSLVLQTTMGCYLPQKVVQCFEKCLG
RLNCWTLYRIARTASRYGHHYVAAHIYTKVSQIVISDHMHYFLVALSQIS
QAECILNYGLEYAYMRDNYAPKVAPEPLIPLMKRLEMASNLYQQALASLR
AGSSPQHPCTFQLEYLKIRAQFLQTLHLAVTVKNAQVIVPPPAIAGSLAQ
NSRDYLQKFGHVTNQLRKLVKALKACEETYARLYKSSFDADHVTLEFLEV
AEFQCALFAHIIESICYATPPEPPVFLTTGDHPETRYFAASCQRMEQMQK
NLPQEPANAKTISNRHLDVIIAQIEIITKTPLCLPRYFFQILQSTQIKLS
VSPQPRSATEPVNVQSGSNLVIKVEGVLQHFSKQKKHFRRVESVQLSLTS
QLITPPPRSSQELPKQGANDTVTLNQIVKPQRDFLSGSFLLPISNGGHFQ
VTLETFVVDENGITWCTGPKSSMVVRVLEDPSKQGAPAPSTSQAVGQTRR
FASFLDH

BO28553.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
defl-PA 1001 CG18176-PA 1..1001 1..1001 5136 100 Plus