Clone BO28555 Report

Search the DGRC for BO28555

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:55
Vector:pDNR-Dual
Associated Gene/Transcriptmbt-RA
Protein status:BO28555.pep: Imported from assembly
Sequenced Size:1972

Clone Sequence Records

BO28555.complete Sequence

1972 bp assembled on 2011-08-04

> BO28555.complete
GAAGTTATCAGTCGACATGTTCTCGAAGAAGAAAAAGAAACCGCTGATCT
CGATGCCCAGCAATTTTGAGCATCGTGTGCACACAGGCTTCGACAAGCGG
GAGAACAAATATGTTGGCCTGCCCCTCCAATGGGCGTCCATTGTGGGCAA
CAATCAGATACTCAAGTCCTCCAACCGCCCGCTGCCACTGGTCGATCCCT
CGGAGATTACGCCCACCGAGATTCTCGATCTGAAGACTATTGTGCGTCCG
CATCACAACAACAACAAGGCGGACACCACCTCGCTCAACAGCAGCAGCAC
AATGATGATGGGCTCAATGGCGCCGATGAATCCCATGGCACCTGGCGCAC
ACCCAATGATGAGCCATGGCCCCGGAATGATGATGCCACCCGAGACGGGC
GGCATAGTCCTGCCGAAGACCTCTCACGTGGCCAGATCCAATTCGCTGCG
GAGTTCCAGTCCGCCGCGAGTGCGACGGGTAGCCAATGTGCCGCCATCGG
TGCCGGAGGAGGAGGGACCACCGGCAGCTGGAACACCGGGAGTAGGTGGA
GCTAGTAGCGGTGGCTTTAAGCCACCCGGTGCCCATCCCTCCCTGCTCTA
TAACAGTCAGCATGCGCACGCGAATGGAGCAACAGGACCACTGGCCGTGC
GCACGGATCAAACCAACCTGCAGCAGTATCGCAGCAATCTGGCCCCGCCA
TCCGGCGGCTCCATGCCCCAGCAACAGCAGACTTCGCCCGTGGGTTCGGT
GGCCAGTGGCACGCGATCCAATCACTCGCACACGAACAATGGCAACAGCG
GCGGCAGCTATCCTCCCATGTATCCCACAAGCCATCAGCAGCAGCAGCAG
CAGCAACAGCAGGCCAAACAGGGTGGCGATCAGAACCAAAATCCTCTGCA
TCCGCATGCTCATCCGCATCCGCACCATCACCAACATTTGGCCAAGTCGG
CGTCCAGGGCATCCAGTTCCAGCGGGGGAGCGAGCAGTGCTGCCCAGCAG
GCGAGCGGCGCCAGTGGAGGAGCGGCGGGTCAGCCAAAGCAGGACCAACG
ACTCACCCACGAACAGTTCCGTGCCGCCCTTCAGATGGTGGTCTCCGCCG
GTGATCCACGCGAGAACCTCGACCACTTTAACAAAATAGGCGAGGGCTCC
ACGGGCACCGTATGCATTGCCACGGACAAATCCACAGGTCGCCAGGTGGC
CGTGAAGAAGATGGATCTGCGCAAACAGCAGCGACGGGAGCTGCTATTCA
ACGAGGTCGTCATCATGCGGGACTACCATCATCCCAATATCGTGGAGACA
TACTCCAGCTTTCTGGTCAACGATGAGCTTTGGGTGGTGATGGAGTACCT
CGAGGGCGGCGCCCTCACCGATATTGTCACCCATTCGCGCATGGACGAGG
AGCAGATAGCCACCGTCTGCAAGCAATGCTTGAAGGCTTTGGCCTATTTG
CACTCACAGGGCGTCATTCATCGCGACATCAAGTCGGACTCGATTCTGCT
GGCCGCCGATGGTCGCGTGAAGCTATCGGACTTTGGATTCTGCGCCCAGG
TGTCACAGGAGCTGCCGAAGCGCAAGAGTCTGGTTGGCACGCCGTATTGG
ATGTCGCCGGAGGTCATATCGCGCCTGCCGTACGGCCCGGAAGTGGATAT
CTGGTCGCTGGGCATCATGGTCATCGAGATGGTGGACGGCGAGCCGCCGT
TCTTCAACGAACCGCCGCTGCAGGCGATGCGTCGCATCCGTGACATGCAG
CCGCCGAACCTGAAGAACGCGCACAAGGTCTCGCCGCGCCTGCAGTCCTT
CCTCGACCGGATGCTGGTGCGGGATCCGGCGCAGCGTGCCACCGCCGCCG
AGCTGCTGGCCCATCCCTTCCTGCGCCAGGCAGGACCGCCGTCGCTGCTG
GTTCCGCTGATGCGCAATGCGCGACACCATCCGGCAAGCTTTCTAGACCA
TTCGTTTGGCGCGCGAAAGGGG

BO28555.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-RA 1920 CG18582-PA 1..1917 17..1933 9570 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-RA 3269 CG18582-RA 508..2424 17..1933 9570 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16611192..16612363 17..1188 5845 99.9 Plus
X 23542271 X 16613534..16614011 1456..1933 2390 100 Plus
X 23542271 X 16612430..16612706 1184..1460 1385 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:57:47 has no hits.

BO28555.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:57 Download gff for BO28555.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 494..2410 22..1941 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:40:08 Download gff for BO28555.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 513..2429 22..1941 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:49 Download gff for BO28555.complete
Subject Subject Range Query Range Percent Splice Strand
mbt-RA 513..2429 22..1941 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:49 Download gff for BO28555.complete
Subject Subject Range Query Range Percent Splice Strand
X 16613538..16614016 1460..1941 99   Plus
X 16612434..16612705 1188..1459 100 -> Plus
X 16611197..16612362 22..1187 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:40:08 Download gff for BO28555.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16507571..16508049 1460..1941 99   Plus
arm_X 16506467..16506738 1188..1459 100 -> Plus
arm_X 16505230..16506395 22..1187 99 -> Plus

BO28555.pep Sequence

Translation from 16 to 1972

> BO28555.pep
MFSKKKKKPLISMPSNFEHRVHTGFDKRENKYVGLPLQWASIVGNNQILK
SSNRPLPLVDPSEITPTEILDLKTIVRPHHNNNKADTTSLNSSSTMMMGS
MAPMNPMAPGAHPMMSHGPGMMMPPETGGIVLPKTSHVARSNSLRSSSPP
RVRRVANVPPSVPEEEGPPAAGTPGVGGASSGGFKPPGAHPSLLYNSQHA
HANGATGPLAVRTDQTNLQQYRSNLAPPSGGSMPQQQQTSPVGSVASGTR
SNHSHTNNGNSGGSYPPMYPTSHQQQQQQQQQAKQGGDQNQNPLHPHAHP
HPHHHQHLAKSASRASSSSGGASSAAQQASGASGGAAGQPKQDQRLTHEQ
FRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMD
LRKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGAL
TDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGR
VKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGI
MVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRML
VRDPAQRATAAELLAHPFLRQAGPPSLLVPLMRNARHHPASFLDHSFGAR
KG

BO28555.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
mbt-PA 639 CG18582-PA 1..639 1..639 3369 100 Plus
Pak-PJ 704 CG10295-PJ 75..698 3..636 939 36.4 Plus
Pak-PE 704 CG10295-PE 75..698 3..636 939 36.4 Plus
Pak-PB 704 CG10295-PB 75..698 3..636 939 36.4 Plus
Pak-PA 704 CG10295-PA 75..698 3..636 939 36.4 Plus