Clone BO28556 Report

Search the DGRC for BO28556

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptMdr49-RA
Protein status:BO28556.pep: Imported from assembly
Sequenced Size:3940

Clone Sequence Records

BO28556.complete Sequence

3940 bp assembled on 2011-08-04

GenBank Submission: KX796396

> BO28556.complete
GAAGTTATCAGTCGACATGGTCAAGAAGGAGGAATCACGGCTGCCACAAG
CTGGTGACTTTCAGCTTAAGGAAGGATCAGTCGTGGATGCGACCCGAAAG
TACAGTTACTTTGATCTGTTCAGATACTCAACCAGATGCGAGCGCTTCCT
GTTGGTAGTCAGTCTGCTGGTGGCCACCGCTGCGTCCGCATTTATTCCCT
ACTTCATGATTATCTACGGAGAGTTCACATCCCTGCTCGTGGACCGAACA
GTCGGCGTGGGCACATCCTCGCCAGCCTTTGCTCTGCCCATGTTTGGTGG
CGGTCAGCAATTGACAAATGCCAGCAAAGAGGAGAACAACCAGGCGATCA
TTGATGATGCGACTGCCTTTGGCATTGGCAGTCTGGTGGGATCTGTGGCC
ATGTTCCTGCTCATCACACTGGCCATCGACTTGGCCAACCGGATAGCCCT
CAACCAAATCGATCGCATCCGAAAGCTCTTCCTGGAGGCAATGCTGCGAC
AGGACATCGCCTGGTACGACACCAGTTCGGGCTCCAACTTCGCCAGCAAA
ATGACAGAAGACCTGGACAAACTGAAGGAAGGCATTGGCGAGAAAATAGT
GATTGTGGTATTCCTGATCATGACCTTTGTGATTGGAATAGTGTCTGCTT
TCGTCTACGGATGGAAGCTCACCCTGGTCGTTCTAAGTTGTGTGCCCTTC
ATCATTGCAGCCACCAGTGTGGTGGCTCGACTCCAGGGATCGCTGGCCGA
GAAGGAGCTGAAGTCCTACTCCGATGCAGCCAACGTGGTCGAGGAGGTAT
TCAGTGGAATTCGCACAGTGTTCGCATTCAGTGGTCAGGAGAAGGAGAAG
GAACGCTTTGGCAAGCTGCTCATTCCCGCAGAGAATACGGGTCGCAAGAA
GGGTCTATACTCGGGCATGGGGAACGCTCTGTCCTGGCTGATCATCTACC
TGTGCATGGCCCTTGCCATCTGGTATGGTGTGACGCTCATTCTGGACGAG
CGTGATCTTCCCGATCGCGTTTATACTCCGGCCGTTCTGGTCATTGTCCT
GTTCGCCGTGATCATGGGTGCCCAGAATCTCGGTTTTGCCTCTCCACACG
TGGAAGCCATTGCTGTGGCCACGGCAGCTGGCCAGACCCTGTTCAACATC
ATCGATCGTCCGTCGCAGGTGGATCCAATGGACGAGAAGGGAAACAGGCC
GGAGAATACCGCTGGACACATTCGTTTCGAGGGCATACGCTTCCGTTACC
CCGCCCGTCCGGATGTGGAGATCCTCAAGGGTCTGACCGTCGATGTGCTT
CCGGGTCAGACGGTGGCCTTCGTGGGCGCATCTGGGTGTGGCAAGAGCAC
CCTCATCCAACTGATGCAGCGGTTCTACGACCCCGAAGCGGGCAGTGTCA
AACTGGATGGACGGGATCTTCGAACACTGAATGTGGGCTGGTTGCGTTCG
CAGATCGGAGTGGTGGGCCAGGAACCGGTTCTCTTCGCCACCACCATTGG
CGAGAATATCCGATACGGAAGACCATCGGCCACTCAGGCGGATATAGAGA
AGGCGGCGCGAGCGGCCAACTGTCATGATTTCATCACTCGCCTACCCAAG
GGCTACGACACCCAGGTGGGCGAGAAGGGCGCTCAGATTTCTGGTGGCCA
GAAGCAGCGGATTGCCATTGCCCGGGCTTTGGTTCGACAGCCCCAAGTGC
TTCTTCTCGACGAGGCCACCTCTGCCCTGGATCCCACCTCTGAGAAGCGG
GTGCAAAGTGCCCTAGAACTGGCCAGCCAGGGACCAACCACTCTAGTTGT
GGCCCACCGACTGTCCACCATCACCAATGCCGACAAGATTGTCTTCCTCA
AGGACGGTGTAGTGGCGGAGCAGGGTACGCACGAGGAGCTCATGGAGCGA
CGTGGTCTCTACTGCGAACTGGTGAGCATCACCCAGCGGAAGGAGGCCAC
GGAGGCGGACGAGGGAGCGGTTGCCGGGCGACCTCTGCAGAAGTCGCAGA
ACCTGTCTGACGAGGAAACCGATGATGACGAGGAGGATGAAGAGGAGGAC
GAAGAGCCGGAGCTGCAGACTTCGGGCAGCTCCAGGGACAGCGGATTCAG
AGCCAGCACGCGACGCAAGCGTCGCTCGCAGCGTCGCAAGAAGAAGAAGG
ACAAGGAAGTGGTATCCAAGGTGTCCTTCACTCAACTAATGAAGCTTAAT
TCTCCGGAGTGGCGTTTCATTGTCGTCGGAGGCATTGCATCCGTAATGCA
TGGCGCCACATTCCCGCTTTGGGGTCTCTTCTTTGGCGACTTCTTTGGAA
TCCTCTCGGACGGTGACGATGACGTTGTGCGAGCCGAGGTCCTAAAAATC
TCCATGATCTTTGTGGGCATTGGCCTGATGGCCGGATTGGGTAACATGCT
CCAGACCTACATGTTCACAACGGCCGGCGTGAAGATGACAACGCGATTGC
GTAAACGGGCTTTTGGAACGATTATTGGTCAGGATATTGCCTACTTCGAT
GACGAGCGGAATTCAGTGGGAGCACTGTGCTCCCGGCTGGCCAGCGATTG
TTCCAACGTTCAGGGTGCAACCGGAGCTCGTGTGGGCACAATGCTCCAGG
CCGTGGCCACTCTTGTGGTCGGAATGGTCGTCGGTTTCGTTTTCTCCTGG
CAACAGACGCTCCTCACACTGGTCACCCTGCCACTGGTCTGTTTGTCCGT
CTACTTGGAGGGTCGTTTTATCATGAAGAGCGCCCAAAAGGCTAAGGCGT
CGATCGAGGAGGCTTCTCAAGTGGCAGTCGAAGCTATTACCAATATCCGA
ACGGTCAATGGTCTTTGCCTAGAGCGCCAGGTCTTGGATCAGTACGTTCA
GCAGATCGATCGCGTGGATATCGCCTGCAGGCGCAAGGTTCGCTTCCGTG
GTCTGGTTTTCGCTCTGGGACAGGCGGCTCCTTTCCTGGCTTACGGCATC
TCAATGTACTATGGTGGTATTCTGGTGGCAGAGGAGCGAATGAACTATGA
GGACATCATCAAGGTGGCCGAGGCTCTGATCTTTGGCTCCTGGATGTTGG
GACAGGCCCTGGCCTACGCGCCAAATGTAAACGATGCTATTCTGTCCGCC
GGACGCCTAATGGATCTCTTCAAGCGCACCTCCACGCAGCCCAATCCGCC
ACAGAGTCCCTACAATACAGTTGAGAAATCCGAGGGAGACATTGTCTATG
AAAACGTGGGCTTCGAATATCCCACCAGGAAGGGCACTCCCATTCTGCAG
GGCCTAAATCTCACCATCAAGAAATCGACGACGGTAGCTCTGGTGGGTCC
ATCTGGTTCCGGCAAGTCCACCTGCGTGCAACTGCTGCTTCGCTACTACG
ATCCCGTATCGGGATCCGTGAATCTGAGCGGAGTGCCGAGCACGGAATTC
CCGTTGGACACACTGCGCTCCAAGCTGGGCCTGGTCTCGCAGGAACCCGT
GCTCTTCGATCGCACCATTGCCGAGAACATAGCTTATGGCAACAATTTCC
GTGACGATGTGTCCATGCAGGAGATTATTGAGGCGGCCAAGAAGTCGAAT
ATCCACAACTTTATAAGTGCTTTGCCCCAAGGCTACGACACCCGACTGGG
CAAGACCTCGCAGCTCTCTGGAGGTCAGAAGCAGCGCATCGCCATCGCTC
GAGCCCTGGTCAGAAACCCGAAGATACTCATCCTGGACGAGGCAACCTCT
GCGCTGGACTTGGAGAGCGAGAAGGTGGTGCAACAGGCGCTGGATGAGGC
GAGATCAGGCCGCACATGCCTGACGATTGCGCATCGTCTGACCACCGTGC
GGAATGCGGATCTCATCTGTGTGCTAAAACGCGGCGTGGTAGTGGAGCAC
GGCACCCACGATGAGTTGATGGCACTGAACAAAATCTACGCCAATCTCTA
TCTGATGCAGCAGGTGTCGGGCGCAAGCTTTCTAGACCAT

BO28556.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-RA 3909 CG3879-PA 1..3906 17..3922 19155 99.4 Plus
Mdr49-RB 3306 CG3879-PB 1..3303 620..3922 16140 99.2 Plus
Mdr65-RA 3909 CG10181-PA 1627..1724 3611..3708 235 82.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-RA 4240 CG3879-RA 231..4136 17..3922 19155 99.4 Plus
Mdr49-RB 3624 CG3879-RB 157..3520 559..3922 16445 99.3 Plus
Mdr65-RA 4135 CG10181-RA 1762..1859 3611..3708 235 82.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12942575..12944138 2122..559 7730 99.6 Minus
2R 25286936 2R 12940427..12941175 3922..3174 3670 99.3 Minus
2R 25286936 2R 12941244..12941852 3175..2567 2910 98.5 Minus
2R 25286936 2R 12941955..12942401 2567..2121 2160 98.9 Minus
2R 25286936 2R 12944522..12944767 558..313 1230 100 Minus
2R 25286936 2R 12944826..12945021 313..118 980 100 Minus
2R 25286936 2R 12945086..12945187 118..17 510 100 Minus
3L 28110227 3L 6243010..6243107 3708..3611 235 82.7 Minus
3L 28110227 3L 6236952..6237064 1732..1620 205 78.8 Minus
Blast to na_te.dros performed on 2014-11-27 00:58:22 has no hits.

BO28556.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-04 15:53:57 Download gff for BO28556.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 229..4134 17..3924 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:40:31 Download gff for BO28556.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 231..4136 17..3924 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:15:06 Download gff for BO28556.complete
Subject Subject Range Query Range Percent Splice Strand
Mdr49-RA 231..4136 17..3924 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:15:06 Download gff for BO28556.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12945086..12945187 17..118 100   Minus
2R 12944827..12945020 119..312 100 <- Minus
2R 12944522..12944767 313..558 100 <- Minus
2R 12942577..12944138 559..2120 99 <- Minus
2R 12941956..12942401 2121..2566 98 <- Minus
2R 12941244..12941852 2567..3175 98 <- Minus
2R 12940425..12941173 3176..3924 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:40:31 Download gff for BO28556.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8832591..8832692 17..118 100   Minus
arm_2R 8832332..8832525 119..312 100 <- Minus
arm_2R 8832027..8832272 313..558 100 <- Minus
arm_2R 8830082..8831643 559..2120 99 <- Minus
arm_2R 8829461..8829906 2121..2566 98 <- Minus
arm_2R 8828749..8829357 2567..3175 98 <- Minus
arm_2R 8827930..8828678 3176..3924 99 <- Minus

BO28556.pep Sequence

Translation from 16 to 3940

> BO28556.pep
MVKKEESRLPQAGDFQLKEGSVVDATRKYSYFDLFRYSTRCERFLLVVSL
LVATAASAFIPYFMIIYGEFTSLLVDRTVGVGTSSPAFALPMFGGGQQLT
NASKEENNQAIIDDATAFGIGSLVGSVAMFLLITLAIDLANRIALNQIDR
IRKLFLEAMLRQDIAWYDTSSGSNFASKMTEDLDKLKEGIGEKIVIVVFL
IMTFVIGIVSAFVYGWKLTLVVLSCVPFIIAATSVVARLQGSLAEKELKS
YSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLLIPAENTGRKKGLYSG
MGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFAVIM
GAQNLGFASPHVEAIAVATAAGQTLFNIIDRPSQVDPMDEKGNRPENTAG
HIRFEGIRFRYPARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLM
QRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRY
GRPSATQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIA
IARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLS
TITNADKIVFLKDGVVAEQGTHEELMERRGLYCELVSITQRKEATEADEG
AVAGRPLQKSQNLSDEETDDDEEDEEEDEEPELQTSGSSRDSGFRASTRR
KRRSQRRKKKKDKEVVSKVSFTQLMKLNSPEWRFIVVGGIASVMHGATFP
LWGLFFGDFFGILSDGDDDVVRAEVLKISMIFVGIGLMAGLGNMLQTYMF
TTAGVKMTTRLRKRAFGTIIGQDIAYFDDERNSVGALCSRLASDCSNVQG
ATGARVGTMLQAVATLVVGMVVGFVFSWQQTLLTLVTLPLVCLSVYLEGR
FIMKSAQKAKASIEEASQVAVEAITNIRTVNGLCLERQVLDQYVQQIDRV
DIACRRKVRFRGLVFALGQAAPFLAYGISMYYGGILVAEERMNYEDIIKV
AEALIFGSWMLGQALAYAPNVNDAILSAGRLMDLFKRTSTQPNPPQSPYN
TVEKSEGDIVYENVGFEYPTRKGTPILQGLNLTIKKSTTVALVGPSGSGK
STCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRT
IAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLGKTSQL
SGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRT
CLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANLYLMQQV
SGASFLDH

BO28556.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Mdr49-PA 1302 CG3879-PA 1..1302 1..1302 6540 100 Plus
Mdr49-PB 1101 CG3879-PB 1..1101 202..1302 5547 100 Plus
Mdr65-PA 1302 CG10181-PA 25..1300 23..1299 2878 45.1 Plus
CG10226-PA 1320 CG10226-PA 23..1316 16..1298 2678 43 Plus
Mdr50-PA 1313 CG8523-PA 45..1312 4..1303 2570 42.2 Plus
Mdr49-PA 1302 CG3879-PA 24..648 714..1307 816 33.4 Plus
Mdr49-PB 1101 CG3879-PB 513..1098 24..640 814 33.5 Plus
Mdr49-PB 1101 CG3879-PB 2..447 865..1307 758 40 Plus