Clone BO28557 Report

Search the DGRC for BO28557

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:285
Well:57
Vector:pDNR-Dual
Associated Gene/Transcriptraw-RB
Protein status:BO28557.pep: Imported from assembly
Sequenced Size:2449

Clone Sequence Records

BO28557.complete Sequence

2449 bp assembled on 2011-08-05

GenBank Submission: KX798795

> BO28557.complete
GAAGTTATCAGTCGACATGCACAAAATGGTTAAATTATTCCTCAGAGAAG
TTCTGAATGCATGGCGAGCAAAGGCCAGATGCAATGTGGTGCCCGACGAA
CGGACACAGGAACTCTTCCACGAGCTAAGCTTCCATCCTAGCCAAAAGCA
GATTAGCGAAATGCTGCAGACTGCCAAGAAAGTGGCCCGCAAGGGAGGAA
GTGGACAGGCAAATGGGCTGACTTTTGGCCAGTTTTGTGTCTTAGCCGCG
GATCTGAAACGTTTCAGAGCTTCAACAATTTCGAATCAGCCATCGTACTG
CGACTATCAGTCTCTGTCCGCGGGACTGCTGCTCCCGGAACTAGATGATC
CTGCCAGCTCGTCCAATCAAAACCTTCAGTCGCCAGCGGCCACCAACTCG
TCACCTGCGCACAGCTCCAAGAAGCCGGATAACCACGGTACCGAACTGAG
GAGTACCAAGTCCTTTAGCAGTGTGGACGATACCAAAAAGAAAAAGAACG
CCACCAATGAGCCCGTCGAGGTTTTCCTTGGCGGATCCTGCAATCCGACA
ACCTGGCGAGCCGACGTTGCCATACCAGCCCTCAAGGAGCTGGGCATTTC
GTTTTACAATCCTCAAGTATCCGATTGGACGCCCGATCTCATCGAGCTCG
AGCATCGAGCTAAGGAAAAGGCCCGTGTATTATTCTTCGTTATGGATTCG
GAAACACGCGCATCTGCTGGTGCCATCGAGGCGGCACACATAGCGGGTCA
AAACTGCAAGCAGCTGGTGTTGGTTTTGCATCCGTATAAACCAAATCAGA
AGATCCTCAATGAGCCTATTTCGCAGCAAGAATACCTCGATCTGAATCGC
AATCAGTTGATACTTAAGGAGCTGGTCTCCCGACGCGGTCTGCCCGTATT
GGATAACATACCACTGGGTCTGCAGCGCACTAAGGATATCCTGGGTGGCA
TCAGGGATCCACCGTCCAAAATATCTTCTATTTTAGATACCGTTCGCGGC
GCCTTTGATCGTGTTAATCCGCTAAACGATCTGCTCACTGTGGAACAATG
CAAACGTGCTCTCTTATTCCTAGGCTATGCTCAGAGTTTAGTTAATTTAG
ACAATCTAAATAAGATCATTATCAACCAACGCGAATCGCTGAAATTGCTC
CAAACGCACAGTCCAAGAGCTGTCGCCGATGATGCGGATGCCGATGGCGG
CAACTGCAGCCAGCCCATCCTCCCCAGCCAGGAGCTCATCGACTTTGATC
TGTTTTGTGTGATCTCGGCGTATCTGTCCGTCCTGCAGCAGGAGATCCAT
GAGAGCGGATGCATTTCGCCCATCAAGGGCACCAATGTGCCGCCACCGCA
AGTTTACTTCACCAACGCTCCCGATGTGGACATTTACTACTCGGCCAGCA
AGAATATTTCGCGCACGTCGAGCAACGCCAGTGTTCCGTCCAATAGTAGC
AGTGGCATCGGACACGACCTGGAGCGCCAGAGTCTCTTCGAGCAGCTCAG
TCGCAGCCGGGACAGTGGAACATCTTCGCCACAGCCCACGGGATCGAGCA
GTTTGGGTAAAAGCCCTCGGCCACAGATCCTGCTAAATGTGGAGTCGATC
GAGACAACGGAAATAATCACCACTAAAACCATAGAGACCAAGCCAAATCC
GGTGACTGCATCAACTGTTGTGCATGCCGAGGAGGAAGAGAGTGATTCCA
ACGACTCGGTCCTCTCCAGCAACAGCTCCATAGCCAGTGCCGGCGATATA
CTCTGCTGCGGTGGTGGCTTGGATCTGCGGGATGTCTATCTGGGCGGAAG
TTGTGTGCTGCGCACCAAGTGGCGTCAGGAACTGGCCGTGCCCTATCTGC
AGTCCAAGGGCGTCAGTTTCCATACACCGGCGCTGCACGAGAGCATCCAG
CAAATGATTCTGAACCAGGAACAGAACCAGGATCAGTCTCAGCAGCCGAC
AGTGCCGCCGCAGGAACAGCAGCAACAGCAGCGTTCCTTTGTGCGCACTC
GGCGAAAGTGCAGGGGCAACCAGCTGCAGCTGGAGGAGCAAGAGGAGCTG
ACCGTGGCCGAGGAGTCACTTAGCTGGTCCCTACCACCGGTCGCCGTTCG
TCAGAGCCTGTTCAACCCATCGCTGCTCGACTCGAGTCGAGTGTTGCTCT
TCGTCATCACCAACGAGACCCGTTCGCTGGCGCCCATGACCCTGGCCGCC
CACTGCATTGGCCTCATGTACAATGTGGTGCTGGCGGTGCAAATGCTGCC
CGAAGACTGTGTCCTGGGTGACGAGAAGCTGACTGTGGCGGCCATCAAGG
ACTACAATCGCGGACGGTCGTACCTGATCGACTTGGCCAAGAGGCAGGGT
GTGCCCGTGTTCAGCGACATTCGGGCAGCCCTCGAGTGCACCGTGGCCAA
GGTGAAGGCGTACAACAACCGCGACCGCTGCGCAAGCTTTCTAGACCAT

BO28557.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
raw-RB 2418 CG12437-PB 1..2415 17..2431 12075 100 Plus
raw-RC 2970 CG12437-PC 581..2967 45..2431 11935 100 Plus
raw-RE 2970 CG12437-PE 581..2967 45..2431 11935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
raw-RB 3220 CG12437-RB 248..2662 17..2431 12075 100 Plus
raw-RC 3954 CG12437-RC 1010..3396 45..2431 11935 100 Plus
raw-RE 4275 CG12437-RE 1331..3717 45..2431 11935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8710727..8711638 2278..1367 4560 100 Minus
2L 23513712 2L 8711701..8712080 1367..988 1900 100 Minus
2L 23513712 2L 8712674..8713022 613..265 1745 100 Minus
2L 23513712 2L 8712388..8712602 828..614 1075 100 Minus
2L 23513712 2L 8712145..8712303 987..829 795 100 Minus
2L 23513712 2L 8710438..8710592 2431..2277 775 100 Minus
2L 23513712 2L 8713089..8713203 267..153 575 100 Minus
2L 23513712 2L 8713264..8713373 152..43 550 100 Minus
Blast to na_te.dros performed 2014-11-27 01:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1046..1130 1901..1982 174 70.6 Plus
roo 9092 roo DM_ROO 9092bp 1060..1142 1897..1982 153 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1461..1584 1862..1982 152 62.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2375 1916..1984 138 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6826..6923 1887..1982 134 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6713..6794 1901..1982 131 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6848 1910..1982 131 64.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2394 1914..1982 129 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6815 1914..1982 129 65.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6809..6893 1898..1982 119 63.2 Plus

BO28557.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-05 11:54:58 Download gff for BO28557.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 248..2662 17..2433 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:58:20 Download gff for BO28557.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 248..2662 17..2433 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:29:04 Download gff for BO28557.complete
Subject Subject Range Query Range Percent Splice Strand
raw-RB 248..2662 17..2433 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:29:04 Download gff for BO28557.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8740385..8740413 17..45 100   Minus
2L 8713264..8713370 46..152 100 <- Minus
2L 8713089..8713203 153..267 100 <- Minus
2L 8712674..8713019 268..613 100 <- Minus
2L 8712388..8712602 614..828 100 <- Minus
2L 8712145..8712303 829..987 100 <- Minus
2L 8711701..8712080 988..1367 100 <- Minus
2L 8710727..8711637 1368..2278 100 <- Minus
2L 8710436..8710590 2279..2433 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:58:20 Download gff for BO28557.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8740385..8740413 17..45 100   Minus
arm_2L 8713264..8713370 46..152 100 <- Minus
arm_2L 8713089..8713203 153..267 100 <- Minus
arm_2L 8712674..8713019 268..613 100 <- Minus
arm_2L 8712388..8712602 614..828 100 <- Minus
arm_2L 8712145..8712303 829..987 100 <- Minus
arm_2L 8711701..8712080 988..1367 100 <- Minus
arm_2L 8710727..8711637 1368..2278 100 <- Minus
arm_2L 8710436..8710590 2279..2433 98 <- Minus

BO28557.pep Sequence

Translation from 16 to 2449

> BO28557.pep
MHKMVKLFLREVLNAWRAKARCNVVPDERTQELFHELSFHPSQKQISEML
QTAKKVARKGGSGQANGLTFGQFCVLAADLKRFRASTISNQPSYCDYQSL
SAGLLLPELDDPASSSNQNLQSPAATNSSPAHSSKKPDNHGTELRSTKSF
SSVDDTKKKKNATNEPVEVFLGGSCNPTTWRADVAIPALKELGISFYNPQ
VSDWTPDLIELEHRAKEKARVLFFVMDSETRASAGAIEAAHIAGQNCKQL
VLVLHPYKPNQKILNEPISQQEYLDLNRNQLILKELVSRRGLPVLDNIPL
GLQRTKDILGGIRDPPSKISSILDTVRGAFDRVNPLNDLLTVEQCKRALL
FLGYAQSLVNLDNLNKIIINQRESLKLLQTHSPRAVADDADADGGNCSQP
ILPSQELIDFDLFCVISAYLSVLQQEIHESGCISPIKGTNVPPPQVYFTN
APDVDIYYSASKNISRTSSNASVPSNSSSGIGHDLERQSLFEQLSRSRDS
GTSSPQPTGSSSLGKSPRPQILLNVESIETTEIITTKTIETKPNPVTAST
VVHAEEEESDSNDSVLSSNSSIASAGDILCCGGGLDLRDVYLGGSCVLRT
KWRQELAVPYLQSKGVSFHTPALHESIQQMILNQEQNQDQSQQPTVPPQE
QQQQQRSFVRTRRKCRGNQLQLEEQEELTVAEESLSWSLPPVAVRQSLFN
PSLLDSSRVLLFVITNETRSLAPMTLAAHCIGLMYNVVLAVQMLPEDCVL
GDEKLTVAAIKDYNRGRSYLIDLAKRQGVPVFSDIRAALECTVAKVKAYN
NRDRCASFLDH

BO28557.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
raw-PB 805 CG12437-PB 1..805 1..805 4115 100 Plus
raw-PC 989 CG12437-PC 187..989 3..805 4073 99.1 Plus
raw-PE 989 CG12437-PE 187..989 3..805 4073 99.1 Plus
raw-PA 989 CG12437-PA 187..989 3..805 4073 99.1 Plus
raw-PD 832 CG12437-PD 36..832 9..805 4065 99.7 Plus